(data stored in SCRATCH zone)

EMBL: CP001069.PE135

CP001069.PE135       Location/Qualifiers
FT   CDS_pept        151579..152361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3904"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   rso:RS04702 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3904"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29011"
FT                   /db_xref="GOA:B2UHG0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG0"
FT                   /protein_id="ACD29011.1"
FT                   /translation="MTSHAVFTGLINLLLGMGLGVAGGLLGIGGGLIAIPLLGYLYGMD
FT                   QHLAQGTALVMIAPNVLIGFWRYHQRHPVHVRSVALICVFSMGATYVAARFAAGLDANL
FT                   LHTAFAVFLIVLAVYFASQLKEKPNAAGAAHAVPHTMPAAALPLMGIASGAMSGIFTVG
FT                   GGLVVVSALVTFFGMPQTRAQGMALALVVPGSLIALAAYAHAGHVDWGTGIPLAAGGVV
FT                   SVSWGVALAYRFSARRLRLAFCAVLLGTALMMLLVKPA"
     atgacgtctc acgcggtttt cacgggcctg atcaatttgc tgctcggcat gggtctcggc        60
     gtggcgggcg gtttgctcgg cattggaggc gggctcatcg ccattcctct gctcggctat       120
     ctgtacggaa tggaccagca cttggcgcag ggcacggcgc tggtgatgat tgcgcccaat       180
     gtgctgatcg gcttctggcg gtatcaccag cggcatccgg tgcatgtgcg ttccgtcgcg       240
     ctgatctgcg tgttctcgat gggggcgacc tacgttgccg cgcgctttgc ggcggggctg       300
     gacgccaacc tgctgcatac ggcgtttgcc gtattcctga tcgtgctcgc cgtgtacttt       360
     gcctcgcagc tcaaggagaa gccgaatgcc gctggtgctg cgcacgctgt gccgcacacc       420
     atgccggccg ccgcgctgcc gttgatgggc atcgccagcg gcgcgatgtc gggcatcttc       480
     acggtggggg gcgggctggt ggtggtgtcg gcgctggtga cgttcttcgg catgccgcag       540
     acgcgcgcgc agggcatggc gctcgcgctg gtggtgccag gctcgctcat tgcactcgcc       600
     gcgtatgcgc atgcgggcca cgtggattgg ggtacgggca ttccgctggc ggccggcggt       660
     gttgtcagcg tgtcgtgggg tgtggccctg gcatatcggt tttcagcgcg gcgtttgcgg       720
     ctggcgttct gcgcagtgct gcttggtacg gcgctgatga tgttgctggt caagccagcc       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page