(data stored in ACNUC7421 zone)

EMBL: CP001069.PE137

CP001069.PE137       Location/Qualifiers
FT   CDS_pept        152811..153029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3906"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3906"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29013"
FT                   /db_xref="GOA:B2UHG2"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG2"
FT                   /protein_id="ACD29013.1"
FT                   /translation="MLTGLTQVAWLGSLPYSRRITFLVDGDKLAYRDAGRKRLTPLGWV
FT                   LVAIFAAPAALCYWWFKQQFAALGYAG"
     gtgctcacgg gcctaacaca agttgcgtgg ctggggtcgc ttccctattc tcgcaggatc        60
     acgtttctgg tggacggcga caagctggcc taccgcgatg ccggacgcaa gcgcctcacg       120
     ccacttggct gggtgctcgt ggccatcttt gcggcgccag cagcgctctg ttactggtgg       180
     ttcaagcagc agtttgcggc actcggctat gccggctga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page