(data stored in SCRATCH zone)

EMBL: CP001069.PE139

CP001069.PE139       Location/Qualifiers
FT   CDS_pept        complement(153991..154494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3908"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   rso:RS05225 probable acyl-CoA thioester hydrolase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3908"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29015"
FT                   /db_xref="GOA:B2UHG4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG4"
FT                   /protein_id="ACD29015.1"
FT                   /translation="MNTQSHQLSMTVLMTPDMANFSGNVHGGHILKLLDQVAYACASRY
FT                   AGRYVVTLSVDQVVFRQPIHVGELVTFLASVNYTGRTSMEIGIKVVTENIRNQVVRHTN
FT                   SCYFTMVAVDDDGKPADVPPLAPANAEERERFEAAQQRRALRQEMEARHKAIKATYSTP
FT                   VSGG"
     atgaatacgc aatcccacca gctcagcatg acggtgctga tgacgcccga catggccaat        60
     ttttccggta acgtgcacgg cggccacatc ctcaagctgc tcgatcaggt cgcgtatgcg       120
     tgcgcgagcc gctacgccgg ccgctatgtc gtgacgctgt cggtggacca ggtggtgttt       180
     cgccagccga ttcacgtagg tgaactggtg acgttcctcg cgtcggtcaa ctacaccggt       240
     cgcacgtcga tggaaatcgg tatcaaggtc gtgacggaaa acatccgcaa ccaggtcgtg       300
     cgccatacca acagctgcta cttcacgatg gtggccgtgg acgatgacgg caagccggcc       360
     gacgtgccgc cgctggcgcc cgccaacgcc gaagaaaggg aacgcttcga agccgcgcag       420
     cagcgccgcg ccctgcggca ggaaatggaa gcgcgccaca aggcgatcaa ggcgacctac       480
     agcacgccgg tttcgggcgg ttga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page