(data stored in ACNUC7421 zone)

EMBL: CP001069.PE141

CP001069.PE141       Location/Qualifiers
FT   CDS_pept        155161..155502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3910"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_6293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3910"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29017"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHG6"
FT                   /protein_id="ACD29017.1"
FT                   /translation="MLFTRWFVAAALLALAPPWVLAQGAGSAPAASPPDPLNADAAVPA
FT                   VAAPRTFDSYHAYRDTGPAPWRETNAAVSSKSDASADGGHAGHVIPASAPAATSNKPAG
FT                   ESMPGMHHH"
     atgcttttca cacgatggtt cgtggctgcc gcgctgctgg cgctggcgcc gccatgggtg        60
     ttggcgcaag gtgctgggtc tgcgcctgca gcatcaccgc ctgacccact gaatgcggac       120
     gcggccgtgc ccgccgtggc cgcgccgcgc acattcgaca gctaccacgc gtatcgcgat       180
     accggcccag caccctggcg cgagaccaac gcggccgtga gctccaagtc agacgcttct       240
     gcggatggcg gccacgcggg gcacgtcata ccagcgagcg caccagccgc cacctccaac       300
     aagcctgccg gcgagtccat gcccggcatg caccaccact ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page