(data stored in ACNUC7421 zone)

EMBL: CP001069.PE146

CP001069.PE146       Location/Qualifiers
FT   CDS_pept        159508..160515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3915"
FT                   /product="lipopolysaccharide-modifying protein"
FT                   /note="SMART: lipopolysaccharide-modifying protein; KEGG:
FT                   ftw:FTW_1815 lipopolysaccharide core biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3915"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29022"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH1"
FT                   /protein_id="ACD29022.1"
FT                   /translation="MRHLKYRLSRVSAKKFWYYFSNASNHFLARATKNGKAETLLKRKS
FT                   GQRRTQDVFDRLSYYNSISEAFDTSCNAVEYSNFLLKSSTSTIVDKHCEIGSTYFYDLV
FT                   DLMDYFGPGYSFDYDCGDVTVEPNHPAFVKSRPIKNSSHNGILLKLDAIRHFSLARDPI
FT                   DFQDKKPMAVFRGPCHQEHRRAFVERCHDLANVNIGDTRKSELGKATYKSPMTIAEQLQ
FT                   YKFIVSVEGNDVATNLKWIMASNSLCFMRRPRYETWFMEGRLIPDVHYVLLKDDYSDLQ
FT                   EKIEHYRKYPGDALAIVRNANRWVAQFMNRDQERLLGLMVIAKYFRLSGQQSFW"
     atgcgtcatc tcaaataccg cttgagcaga gtctctgcaa aaaaattctg gtattacttt        60
     tcgaatgcct ctaaccattt tctcgcgcgt gctacaaaaa atggaaaagc tgagacgctt       120
     ctgaaaagaa aaagtggtca gcgtcgtacg caggacgtct tcgatcgatt gagctattac       180
     aactcaattt cggaggcatt cgacaccagt tgcaatgccg tggaatattc aaatttcttg       240
     ttgaaatcct caacaagcac catcgtcgac aagcattgtg aaatagggag tacctatttc       300
     tatgatctgg tcgacctgat ggattatttt ggtccgggat acagctttga ctacgactgc       360
     ggggatgtga ctgtcgagcc gaaccacccg gcgttcgtaa aaagccgccc gatcaagaac       420
     agctcccata atggcattct cttgaagctc gacgccatcc ggcatttttc gctggcacgc       480
     gaccccatcg atttccaaga caagaagccc atggcggtct ttcgggggcc gtgccatcag       540
     gaacaccgca gggcgtttgt ggagcgatgt catgacctgg caaacgttaa catcggggat       600
     actcgaaaat cagaacttgg gaaagcgact tacaaatcgc cgatgacgat tgcggagcaa       660
     ttgcaataca aatttattgt gagtgtcgag ggaaacgacg ttgcaacgaa tttgaaatgg       720
     atcatggcgt ccaattcgct gtgcttcatg aggcggcccc ggtatgagac gtggttcatg       780
     gaaggaaggt tgatcccgga cgtgcattat gtccttctga aagatgatta ttccgacctc       840
     caggagaaaa ttgagcatta ccggaaatac cctggcgatg cattggcgat cgtccgcaac       900
     gccaatcggt gggtggcgca attcatgaac cgtgaccagg aacgcctgct cggtttgatg       960
     gtgatcgcaa agtatttccg gttgtcgggc caacagtcgt tttggtaa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page