(data stored in ACNUC7421 zone)

EMBL: CP001069.PE147

CP001069.PE147       Location/Qualifiers
FT   CDS_pept        160642..161433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3916"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: rso:RS05217
FT                   probable hydroxylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3916"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29023"
FT                   /db_xref="GOA:B2UHH2"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH2"
FT                   /protein_id="ACD29023.1"
FT                   /translation="MSASAPTATHAHPLSDEQQAFFKEHGYVVLRGFASQQVSAALLAA
FT                   AQDGLASAAAPVELETDVGYAGAPTSREAEGGQTVRRLLDADSRGTPYTEWARDPRVAA
FT                   AIAQLIGGPVHLSLAHHNCVMTKHPAFGTATHWHRDSRYWSFARNELVSSWLALVEETV
FT                   DNGCLWVIPGSHTLDLPADRFDAKLFLRQEQPENRALIDTARPVPLLPGDVLLFHCNTF
FT                   HAARANQTAAVKFSAVFTYYGPDNYPLPGTRSSARPDPLVG"
     atgtctgcgt ctgcccccac cgccacccac gcacatccgc tttccgacga gcagcaagcc        60
     ttcttcaagg agcacggcta cgtcgtgttg cgcgggtttg ccagccagca ggtgagcgcc       120
     gcgttacttg ccgccgcaca ggacgggctg gccagcgcgg cggcgccggt ggagctggaa       180
     accgacgtcg gctatgccgg agcaccgacc tcgcgcgaag ccgaaggggg ccagacggtg       240
     cgccgcctgc tcgacgccga ttcacgcggc acgccttata cggaatgggc gcgcgacccg       300
     cgcgtggccg ccgcgattgc acaactgatt ggcggccctg tgcatctttc gctcgcgcac       360
     cacaactgcg tgatgaccaa gcaccccgcg tttggcacgg ccacccattg gcaccgcgac       420
     agccgttact ggtcgttcgc acggaacgaa ctggtgtcgt cgtggctggc cctggtggaa       480
     gagacggtcg acaacggttg tctgtgggtg attccgggca gccacacgct ggacctgccc       540
     gctgaccggt tcgacgccaa gctgttcctg cgccaggagc agccagagaa ccgcgcgctg       600
     atcgacaccg cgcgccccgt gccgctgctg cccggcgacg tgctgctctt ccactgcaac       660
     accttccatg cggcccgtgc caaccagacg gccgccgtca agttctcggc agtgttcacg       720
     tattacggtc ccgataacta cccgttgccg ggcacgcgct cgtcggcgcg gcccgatccc       780
     ctggtcggtt ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page