(data stored in SCRATCH zone)

EMBL: CP001069.PE15

CP001069.PE15        Location/Qualifiers
FT   CDS_pept        complement(13506..13937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3775"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS02233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3775"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28891"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH40"
FT                   /protein_id="ACD28891.1"
FT                   /translation="MIPHRDAVVCGANQRDATSAGASPPRPPAAEREECVDAVLGKPEQ
FT                   DIPERRTADRPPHARDERLEAQRSGPRADIEQAARDIDSGQLDTDLHNTPGVERVVREH
FT                   HAANREDPDRRVANRSADDLADKRNEAGRPGPSRAERKP"
     atgatcccgc atcgagatgc tgtcgtctgc ggcgccaacc agcgcgacgc aacgtccgca        60
     ggcgccagtc cgccgcgccc gccagccgca gaacgggaag aatgcgttga cgccgtattg       120
     ggcaagcccg agcaggacat accggagcgc agaacggcag accgcccgcc gcatgcgcgc       180
     gatgagcggc tcgaggcaca gcgctccggc ccgcgcgccg atatcgaaca ggccgcgcgc       240
     gacatcgaca gcgggcagct cgacaccgat ctgcacaaca ctcccggggt tgagcgcgtg       300
     gtgcgcgaac accatgcagc caaccgtgaa gatcccgatc ggcgggttgc caaccgcagt       360
     gcggacgacc tggccgacaa gcgcaacgag gccggcaggc ccggccccag tcgcgcagaa       420
     cgcaagccct ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page