(data stored in SCRATCH zone)

EMBL: CP001069.PE154

CP001069.PE154       Location/Qualifiers
FT   CDS_pept        complement(168140..168913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3923"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: reh:H16_B2488
FT                   ABC-type transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3923"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29030"
FT                   /db_xref="GOA:B2UHH9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHH9"
FT                   /protein_id="ACD29030.1"
FT                   /translation="MTTEAVLLHLRYLLIGPYPNGPLAGAALTLWMALWACVMATAAGV
FT                   GCALLLDRLDATPGLRRLARLLRGLLATLRAIPVLMLMFWAYFLIPMALGVSVPETATV
FT                   VAALAAVGAAYITQSMEAGLRAVGAGQRNAALALGMSPPQALLTVVLPQAWRIMLPSLA
FT                   NQWVSTVKDTSLAYIVGVVELSTAASQVNSRTVAYPAEVFGAVAVLYFLLCTGIEALPN
FT                   WLRAGPRTPAAQPDHMSTWQRFLRWRERPVSDAVT"
     gtgacgacgg aagccgtgct cctgcacctg cgttacctgc tgatcggacc gtatccgaat        60
     ggtccgctgg ccggggcggc gctcacgttg tggatggcgc tgtgggcctg cgtgatggcc       120
     acggcagcgg gcgtcggttg tgcgctgttg ctggacaggc tcgacgccac gccgggcttg       180
     cgccggttgg cgcgcctgct acgcgggctg ctggccacgc tgcgggctat cccggtactc       240
     atgctgatgt tctgggcgta ctttctgatc cccatggccc tgggcgtgtc ggtgccggaa       300
     accgccacgg tggtcgctgc acttgccgcc gtgggcgcgg cctacatcac ccaaagcatg       360
     gaagccggct tgcgtgccgt cggtgccggg cagcgcaatg cggcactggc gctgggcatg       420
     tcgcccccac aggcgctgct gaccgtggtg ctgccgcagg cgtggcgcat catgctgccg       480
     tcactcgcca accaatgggt atcgacggtc aaggacacat cgctggcgta tatcgtgggc       540
     gtggtggaac tgtccaccgc cgccagccag gtcaacagcc gcacggtggc ctacccggcc       600
     gaggtgttcg gcgcggtggc cgtactgtat ttcctgctgt gcaccggcat cgaggccttg       660
     cccaattggt tgcgcgcagg cccccgcacg cctgcggcgc aaccggacca catgtcgacc       720
     tggcaacgct ttttgcgctg gcgcgaacgc cctgtttcag atgccgtgac ttga             774
//

If you have problems or comments...

PBIL Back to PBIL home page