(data stored in ACNUC7421 zone)

EMBL: CP001069.PE156

CP001069.PE156       Location/Qualifiers
FT   CDS_pept        complement(169674..170561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3925"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: reh:H16_B2490 ABC-type transporter, periplasmic
FT                   component: PAAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3925"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29032"
FT                   /db_xref="GOA:B2UHI1"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI1"
FT                   /protein_id="ACD29032.1"
FT                   /translation="MQASVSGAFSLQGLTQALRKLSRQAVGVVIGAALAVAVLHAPQAH
FT                   ADKLDDIKKAGVLRVGVFDANPPFGYADAKTGQPVGLDVDYAQEIANKLGVKLELRATN
FT                   PANRVPLLTSGKVDIVAANFTITDERKKQIEFSTPYFASGLQFIARKGVLKQPDDLKRD
FT                   GIRLGVDKGTTQETTLRDGYPKARVIAYDDSPLALTALRTGAIQAFAQDGAKLGALLAT
FT                   LPNRSELEISPFVLTREYMGIGVPKGETKLTATIDQILQGLEKDGTAGRIYDRWFGPKS
FT                   AAPLPRDFIIGSTK"
     atgcaggcaa gcgtttcggg cgcattttcg ttgcaaggtc tgacgcaagc gctgaggaaa        60
     ttgtcgcgcc aggcagtggg ggtggtcatc ggggcggcgc tcgcggtggc ggtgctgcac       120
     gcgccgcaag cccacgccga caagctggac gacatcaaga aggcgggtgt gctgcgggtg       180
     ggcgtgttcg atgccaatcc gcccttcggt tacgccgatg ccaagaccgg tcagcccgtt       240
     gggttggacg tggactacgc gcaggaaatc gccaacaagc tgggcgtcaa gctggaactg       300
     cgcgccacca acccggccaa ccgcgtgccg ctgctcacct cgggcaaggt cgatatcgtg       360
     gccgccaact tcaccattac cgacgagcgc aagaagcaga ttgaattcag cacgccgtac       420
     tttgccagcg gcctgcagtt catcgccagg aagggggtgc tcaagcagcc ggacgatttg       480
     aagagggacg gtatccgcct cggtgtcgac aagggcacca cgcaggaaac cacgctgcgc       540
     gacggctatc ccaaggcccg cgtgatcgcc tatgacgatt ccccgctggc gctcaccgca       600
     ctgcgcaccg gtgccatcca ggcatttgca caggatggtg ccaagctcgg cgcgctgctt       660
     gccacgctgc ccaaccgcag tgagctggag atctcgcctt tcgtgctgac gcgcgagtac       720
     atgggcatcg gtgtgccgaa gggtgaaacg aagctgacgg ccaccatcga ccagatcctg       780
     caagggcttg agaaggacgg caccgccggc cgcatctatg accgctggtt cggcccgaag       840
     agcgccgccc cgctgccgcg cgacttcatc atcggcagca ccaagtga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page