(data stored in ACNUC7421 zone)

EMBL: CP001069.PE16

CP001069.PE16        Location/Qualifiers
FT   CDS_pept        complement(14139..15458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3776"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   aav:Aave_2002 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3776"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28892"
FT                   /db_xref="GOA:B2UH41"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH41"
FT                   /protein_id="ACD28892.1"
FT                   /translation="MPRPRGTGRTTFLAMSDPLPTHSTQAPPGPGPAPQPTLLTGLQQP
FT                   AWRLAMVLVAIGGTLVFLQWARVFLVPLTFGVVLAFALNPLVVRLQHWYVPRPVAAAVI
FT                   VLGLWLAGGAVVFGMQDGVSAVAERVPLAAERMAESVDRVRDRLSGAVDKMRQVTTAVE
FT                   HATEGVPAKPPSQPARRPAAAAPPAPHDTLPVLPLREFVWTGSASLFALAGQLVVVSFL
FT                   VYFLLASGQALKRKWVRAVGRTLSEKKRAVRMMAGIGTQIQYSLLVLFASNIMLGILTA
FT                   VAFALLGMDDATVWGLAAAVLHFVPYLGSVVMVVASGIGAYLQMGTWADALIVAGTTLV
FT                   FATLVGTLLMTWLQSRASKLDPCVVYIGLLLWGWLWGVWGLLLGTSVTAMIKVVCDHVE
FT                   RLRPLGVLLGTTDAPAGVWQRLLDRLRGRPTRRRQGAPRR"
     atgccgcgcc cgcgcggaac agggcgcacc acgttccttg ccatgtccga cccgcttccg        60
     acccactcga cgcaggcgcc tccaggcccc gggccggcgc cccagccgac gctattgacc       120
     ggcctccagc agccggcgtg gcggctggcg atggtgctgg tcgccattgg cggcacgctg       180
     gtcttcctgc agtgggcccg cgtgttcctg gtgccgctta cgtttggtgt ggtgctcgca       240
     tttgcgctga atccgctggt ggtacgcctg cagcattggt atgtgccgcg ccccgtggca       300
     gcggctgtca tcgtgcttgg cttgtggctc gcaggcggtg cggtggtctt cggcatgcag       360
     gatggcgtgt ctgccgtggc cgagcgcgtt ccgctggcgg cagagcgcat ggctgaatcg       420
     gtcgatcggg tccgtgatcg cctgagcggt gcagtggaca agatgcggca agtgacgacg       480
     gccgtcgagc atgcgaccga aggcgtgccg gccaagccgc cgtcgcagcc tgcacggcgt       540
     ccggcggcag ccgcgccacc cgcgccacac gacacgctgc cggtattgcc cctgcgcgag       600
     ttcgtgtgga caggatcggc cagcctgttt gccctggccg ggcaactggt ggtggtctcg       660
     ttcctcgtgt acttcctgct cgcttccggg caggcgctca agcgcaaatg ggtacgggcg       720
     gttggtcgca ccctgagcga gaagaagcgg gcggtgcgga tgatggccgg gatcggcacc       780
     cagatccaat actcgctgct ggtgctcttc gccagcaaca tcatgctggg gatcctgacg       840
     gccgtggcct ttgcgcttct gggtatggac gacgcgacgg tgtggggcct ggcggcggcc       900
     gtgttgcact tcgtgccgta cctcggttcg gtcgtgatgg tggtggccag cggcatcggc       960
     gcctatctgc agatgggcac ctgggcggat gcgttgatcg tggcgggaac gaccctcgtg      1020
     tttgccacgc tggtcggcac gttgctcatg acctggctgc agagccgtgc gtccaagctg      1080
     gacccgtgcg tggtctatat cgggttgctg ctgtggggct ggctgtgggg agtgtggggg      1140
     ttgctgctgg ggacctctgt cacggcaatg atcaaggtgg tgtgcgatca cgtcgagcgg      1200
     ctgcgcccgc ttggcgtcct gcttggcacg accgacgcgc ccgcgggggt atggcaacgc      1260
     ctgctcgatc gtctgcgcgg caggccgaca cggcgccggc aaggcgcgcc gcggcgttga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page