(data stored in ACNUC7421 zone)

EMBL: CP001069.PE160

CP001069.PE160       Location/Qualifiers
FT   CDS_pept        complement(175668..176588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3931"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: rso:RS05190 probable
FT                   hydrolase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3931"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29036"
FT                   /db_xref="GOA:B2UHI5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI5"
FT                   /protein_id="ACD29036.1"
FT                   /translation="MPTRRAFNTGLLAMLGSTALAGCAATGNSDATRGTSAGITAIDTH
FT                   AHVFERGLPLADARRYAPTYDAPLPAYLAQLDAHGVSHGVLVQPSFLGVDNSYLLAALK
FT                   QAPQRLRGVAVIDPAAPETLLAQMNAEGIVGIRLNLIGAADPQLKSPVWQASLARLHAL
FT                   GWHVELHVEARRLPALLQPLQEAQVNVVVDHFGRPDPALGVDDPGFAALLAAGRSRRVW
FT                   VKISGAYRNGANGRGEAIAQAAMPRLKDALGLDRLVWGSDWPHTQFESQIDYDKMWAFA
FT                   GVLLPSAADRKQVLVDTPAQLFRFG"
     atgcccaccc gccgcgcctt caacaccgga ttgcttgcca tgctaggttc caccgccctt        60
     gccggctgcg ccgccaccgg caacagcgac gccacgcgcg gcacttccgc gggcatcact       120
     gccatcgata cgcatgcgca tgtattcgag cgcggcttgc cgctggccga tgcgcgccgc       180
     tatgcgccca cgtatgacgc gccgctgccg gcctacctgg cgcagctcga cgcgcatggc       240
     gtgtcgcacg gtgtgctggt ccagccgagc ttcctgggcg tcgacaacag ctacctgctg       300
     gccgcgctca aacaggcgcc gcagcgcttg cgcggcgtgg ccgtcatcga cccggccgcg       360
     cccgaaaccc tgctcgcgca gatgaacgcc gagggcatcg tcggcatccg cctgaacctg       420
     atcggtgcgg cagacccgca attgaaatcg cccgtgtggc aagcctcgct ggcacgcctg       480
     catgcgctgg gctggcatgt ggaactgcac gtcgaggcac gccgcctgcc cgcgctgctg       540
     cagccgctgc aggaagcgca ggtgaacgtg gtggtcgatc atttcggccg tcccgacccg       600
     gcactcggcg tggacgaccc cggctttgcc gcattgctcg ccgccggccg ctcgcgccgc       660
     gtgtgggtga agatttccgg tgcctaccgg aatggcgcca acggacgcgg cgaagccatc       720
     gcgcaggccg ccatgccgcg cctgaaagat gcgctcggcc tggaccgcct ggtatggggc       780
     agcgactggc cgcacacgca gttcgaatcg cagatcgact acgacaagat gtgggccttc       840
     gccggcgtgc tcctgcccag cgcagcggac cgcaagcagg tgctggtcga cacgcccgcg       900
     caattgttcc gcttcggctg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page