(data stored in ACNUC7421 zone)

EMBL: CP001069.PE161

CP001069.PE161       Location/Qualifiers
FT   CDS_pept        complement(176644..177891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3932"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: rso:RS05189 probable
FT                   metabolite transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3932"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29037"
FT                   /db_xref="GOA:B2UHI6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI6"
FT                   /protein_id="ACD29037.1"
FT                   /translation="MFGWFKEISKGEKRTFWACFGGWALDALDVQMFSLVIPTIIAAWH
FT                   IGKAEAGLVSGITLVASALGGWIAGALTDRFGRVRTLQITVLWFSLATFASAFAQNFEQ
FT                   FLVLKAIQGFGFGGEWAAGAVLMAESIRASHRGKAMGTVQSAWAVGWGAAVLLYALTYS
FT                   FIEPDLAWRVMFAAGLLPALLIIYIRRGVQEPVPAATPDANANAMPISRFPLLDIFRPQ
FT                   VLRMTLIGGLLGVGAHGGYYALMTWLPTYLKTERHLSVLGTGGYLAVIIFAFWCGCVAS
FT                   AWLLDVLGRRGNILLFSCCCVVTVLVYLLVPLSDGAMLVLGFPLGFFAAGIPASMGALF
FT                   NELYPQGVRGTGVGFCYNFGRVVSAAFPVLVGKMSASMSLGTAIGIDAAIAYSIVAVAV
FT                   LMLPETKGRDLAAVTV"
     atgttcggct ggttcaaaga gatttcgaaa ggggaaaagc gcacgttctg ggcctgcttt        60
     ggcggctggg cgctcgacgc gctggacgtg cagatgttca gcctcgtcat cccgaccatc       120
     atcgcggcct ggcacatcgg caaggccgag gcggggctgg tgtcgggcat cacgctggtg       180
     gcgtcggccc tgggcggctg gattgccggc gcattgaccg accgcttcgg ccgcgtgcgt       240
     acgctgcaga tcacggtgct gtggttctcg ctggccacat tcgcctcggc cttcgcgcag       300
     aatttcgagc agttcctggt gctcaaggcc atccagggtt tcggctttgg cggcgaatgg       360
     gcggcgggcg ccgtgctaat ggccgagagc attcgcgcca gccaccgcgg caaggccatg       420
     ggcaccgtgc agagcgcatg ggccgtgggc tggggcgcgg cggtgctgct gtatgcgctc       480
     acgtattcct tcattgaacc cgatcttgcc tggcgcgtga tgttcgctgc ggggttgctg       540
     ccggcgctgc tcatcatcta catccgccgt ggcgtgcagg aacccgtgcc ggcggccacg       600
     ccggatgcga acgccaacgc gatgccgatc tctcgctttc cgctgctcga catcttccgc       660
     ccgcaggtgc tgcgcatgac gctgatcggc ggcctgctgg gcgtgggcgc gcatggcggc       720
     tactacgcgc tgatgacgtg gctgccgacg tatctgaaga cagagcggca cttgtcggtg       780
     ctcggcacgg gcggctacct ggcggtgatc atcttcgcct tctggtgcgg ctgcgtggcc       840
     agtgcatggc tgctggacgt gctcggccgt cgcggcaaca tcctgctgtt ctcgtgctgc       900
     tgcgtggtga cggtgctggt gtatctgctc gtaccgctgt cggatggcgc gatgctggtg       960
     ctgggctttc cgctgggctt ctttgcggcg ggcattccgg ccagcatggg cgcgttgttc      1020
     aacgagctgt atccgcaggg cgtgcgcggc acgggcgtgg gcttttgcta caacttcggc      1080
     cgcgtggtgt ctgccgcgtt cccggtgctg gtgggcaaga tgagcgcctc gatgtcgctg      1140
     ggcacggcca tcggcatcga cgcggccatc gcgtattcga tcgtcgcagt ggccgtgctg      1200
     atgctgcccg aaacgaaggg ccgcgacctc gctgccgtta cggtctga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page