(data stored in ACNUC7421 zone)

EMBL: CP001069.PE162

CP001069.PE162       Location/Qualifiers
FT   CDS_pept        complement(178027..180849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3933"
FT                   /product="malto-oligosyltrehalose synthase"
FT                   /note="KEGG: rso:RS05188 putative maltooligosyl trehalose
FT                   synthase transmembrane protein; TIGRFAM:
FT                   malto-oligosyltrehalose synthase; PFAM: alpha amylase
FT                   catalytic region; SMART: alpha amylase catalytic sub
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3933"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29038"
FT                   /db_xref="GOA:B2UHI7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI7"
FT                   /protein_id="ACD29038.1"
FT                   /translation="MSELTTPPAPVTLQRVPRATVRLQLHRDFTFDHARALLDDFAALG
FT                   ISHLYTSPITTAQPGSTHGYDVVDPTHVNPELGGERALEQLVDALHARGMGLVVDIVPN
FT                   HMGVGGAHNTWWLDVLESGPESTYANFFDIDWQPPNPALRNKVLAPFLGENYADALAGG
FT                   RLQLTYDDTAARLAIAYYDHRFPIALADYAALLRAGNADTATHAVADRFAALGTIRSLR
FT                   TRRERADEARDALRNLATTEAGAAHIAEAVRTLNAQPDQLDALMARQHWRLAHWCTAND
FT                   EINWRRFFDIGSLAGLRMERAEVFEATHALLFRLYRLGWIDGVRIDHVDGLADPAAYCR
FT                   QLRRRLQDEHAARPADRLTNHPWIVVEKILASDEPMRTDWGVDGTSGYDFMNQVGALLH
FT                   DAHGETALTQGWLEWIGAPVADAPFSATTAPARRQILHVHFAAELDSATSALHAVAQQN
FT                   HSSHDVTWHAIRRALAEVIVHFPVYRTYANAQQRDAQDSAILQTAMSRAATCLRRVDQP
FT                   VLGWLDAWLGGQPAGQDKLRQLALRRCQQLSSPVAAKAVEDTACYRYGRLLSRNEVGAN
FT                   PGEFSMSANAFHHAMQARAHTWPHAMLTTATHDHKRGEDVRARLAVLSERPTQWLAAAH
FT                   QWRAEHAAWVQKLPAGPAPSPAAQWMLYQTLVGIWPADLDWHDADAVRELAERVAQWQE
FT                   KAQREAKLRTDWFAPDADYEAASRNFVFTLLTGEAAPTFLPSLCAFVQSVAPAAAINGL
FT                   VQTLLRTTLPGVPDLYQGADFWDTSLVDPDNRRPVDYAARHRALRALHLHAGHGLASLL
FT                   AHWTDGRIKQAVLARALALRAALPAVFESGDYQPLAVTGSGAQHVLAFARVHGANAIIV
FT                   IVPLHASALLGHAPAPTFADGAWRDTTVCLPSTLSHLPLHNAFDGQTLHSPRLALGQVL
FT                   AHLPVALLHT"
     atgagcgaac tgaccacacc ccccgcaccc gtcaccctcc aacgtgtgcc gcgcgccacg        60
     gtgcggctgc aactgcaccg cgactttacg ttcgaccatg cgcgcgcgtt gctggatgac       120
     ttcgccgcgc tcggcatctc gcacctctac acgtcgccca tcaccacggc gcaaccgggc       180
     tccacgcatg gctatgacgt cgtcgacccc acacacgtga accccgagct gggcggcgaa       240
     cgcgcgctcg aacagttggt ggatgcgctg catgcgcgcg gcatggggct cgtcgtcgat       300
     atcgtgccaa accacatggg cgtggggggc gcgcacaaca cgtggtggtt ggacgtgctc       360
     gaatccggcc ccgagagcac ctacgccaac ttcttcgata tcgactggca accgcccaac       420
     ccggccctgc gcaacaaggt gctcgcgccc ttccttggcg aaaactacgc cgacgcgctg       480
     gccggcggcc gactgcagct gacctacgac gacacggctg cgcgcctggc gattgcgtac       540
     tacgatcacc ggttcccgat tgcgctggcc gactatgccg cgttgcttcg cgcgggcaac       600
     gctgacaccg ccacccacgc ggtggccgac cgctttgccg cgctcggcac gatccgctca       660
     ctgcgcacgc gccgcgaacg tgccgacgaa gcacgcgacg cgctgcgcaa cctcgccacc       720
     acggaagccg gcgccgcaca catcgcagaa gccgtgcgca cgctcaatgc gcaacccgat       780
     caactcgatg cgctgatggc gcgccagcac tggcgccttg cccattggtg caccgccaat       840
     gatgagatca actggcgccg cttcttcgat atcggctcgc tggccggcct gcgcatggag       900
     cgcgccgaag tctttgaagc cacgcacgcg ctgctgttcc ggctctatcg cctgggctgg       960
     attgacggcg tgcgcatcga ccacgttgat ggcctggccg atcctgccgc ctactgccgc      1020
     cagctacgcc gccgtctgca agacgagcat gccgcacgcc ccgccgaccg gctcacgaac      1080
     cacccgtgga tcgtcgtcga aaagatcctc gccagcgatg aacccatgcg caccgactgg      1140
     ggcgtcgacg gcaccagcgg ctacgacttc atgaaccagg tgggcgcact gttgcacgac      1200
     gcgcacggcg agaccgccct cacccagggc tggctggagt ggatcggcgc accggtggct      1260
     gacgcgccgt tctccgcgac gactgcgccc gcacgccgcc agatcctgca tgtgcacttt      1320
     gcggcggaac tcgattcagc cacgtcggcg ctgcacgcgg tggcgcagca gaaccacagc      1380
     agccacgacg tgacgtggca cgccatccgc cgcgcactgg ccgaggtgat cgtccacttt      1440
     ccggtgtatc gcacctatgc gaatgcgcaa caacgcgacg cacaggattc ggccatcctg      1500
     caaaccgcca tgtcgcgggc ggcgacctgc ctgcggcgcg tcgatcagcc tgtgctcggc      1560
     tggctcgatg cttggctggg cgggcaaccg gccgggcagg acaaactgcg ccaactggcc      1620
     ttgcggcggt gccagcagtt atcgtcgccg gtggcggcca aggcggtgga agacacggcg      1680
     tgctaccgat acgggcggct gctgtcgcgc aacgaggtcg gcgcgaatcc gggcgagttt      1740
     tccatgagcg ccaacgcgtt ccatcacgcc atgcaagcgc gcgcccacac gtggcctcac      1800
     gcgatgctca ccaccgccac gcacgaccac aagcgcggcg aagacgtgcg cgcgcgattg      1860
     gccgtgctgt ctgagcgtcc gacgcagtgg ctggccgccg cacaccaatg gcgtgcggaa      1920
     cacgctgcgt gggtgcaaaa actgcctgcc ggccccgcgc cctcgcccgc cgcgcagtgg      1980
     atgctgtatc aaacgctggt gggcatctgg ccggcggacc tcgactggca tgacgccgat      2040
     gccgtgcgcg agttggccga gcgcgtcgca cagtggcagg aaaaggcgca gcgcgaagcc      2100
     aagctgcgca ctgactggtt cgcgcccgat gcggactacg aagccgccag ccgcaatttc      2160
     gtcttcacgc tgctgacagg cgaagcggcc ccgaccttcc tgccttcgct ctgcgctttc      2220
     gtgcaaagcg tggcgcccgc cgcggccatc aacggcctcg tgcagacctt gctgcgcacc      2280
     acgctgcccg gcgtgcccga cctctatcag ggcgccgatt tctgggacac cagcctcgtt      2340
     gatcccgaca accgccggcc cgtcgactac gccgctcggc accgcgcatt gcgggcattg      2400
     cacttgcatg cgggccatgg cctcgcgtca ctgctcgcgc attggaccga cggccgcatc      2460
     aagcaagccg tactggcacg tgcactggcc ctgcgtgccg cgctgccagc ggtgttcgaa      2520
     tccggcgatt accaaccgct ggccgtgacc ggcagcggcg cacagcacgt gttggcgttt      2580
     gcgcgtgtgc atggcgccaa cgcgatcatc gtgatcgtgc cgctgcatgc ctccgcactg      2640
     ctgggccatg cccccgcacc aacgttcgcg gatggtgctt ggcgggacac cacggtctgt      2700
     ttgccgtcca cgctctcgca tcttcccctg cataacgcat tcgacggcca gacactgcac      2760
     agcccgcgcc tggcgttggg ccaggtgctg gcgcacttgc cggtcgccct gctgcatacc      2820
     tga                                                                    2823
//

If you have problems or comments...

PBIL Back to PBIL home page