(data stored in ACNUC7421 zone)

EMBL: CP001069.PE163

CP001069.PE163       Location/Qualifiers
FT   CDS_pept        complement(180846..183128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3934"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: rso:RS05187 putative
FT                   4-alpha-glucanotransferase (amylomaltase) protein; TIGRFAM:
FT                   4-alpha-glucanotransferase; PFAM: glycoside hydrolase
FT                   family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3934"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29039"
FT                   /db_xref="GOA:B2UHI8"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI8"
FT                   /protein_id="ACD29039.1"
FT                   /translation="MDRTTNLSGTPRTPLQQLATDAGLLVDWEDAASRPMRVADEVLRA
FT                   VLFTLGLPAGTPAQVSESQARLRAEAEAVAIPPLVTGVVGQPIVLQTSAPQAALLDGQP
FT                   YRVDFESDGSTEGRISVSASEHHATLRLAAVQAVGYHRLTIDAGPGTVIEATLAIAPAR
FT                   CYGVADALRQHDRPTDSRLWGASAQLYGLRCDAERAASSAGLGDYTAAGTLARHLSQRG
FT                   ADALALSPVHAMFTADPRRYSPYSPSSRLFLNAWMIDPAALFGNETVRQAVVDCNLVAD
FT                   YARLEAAPLIDWPASGNARMTVLRALHRRLLQAPLGDTIGQTLLDDFRAYCINGGASLR
FT                   DHAHFEALNAHLGPAHWKQWPAQYQDPSYLGVQAFAREHEDAVNFHLFLQWAAARQWAI
FT                   AQRTAEGAGMAIGLVADLAVGTDSAGSHAWARQRDLLIGVTVGAPPDVFNAQGQGWGLT
FT                   TFSPRAMRTQGFSAFIEMLRAVMAVPGGVRIDHVLGLMRLWVIPDGARPLDGVYLRYPM
FT                   QDLLRLVALESWRNRCIVIGEDLGTVPAGLRDKLADDGLLGMRILWFEREYTRDDAPFK
FT                   APRTWAPASVAMTSTHDLPTLVGWWIGNDLRWQAQLGLLPAGMSESEAHARRMDDRAAL
FT                   VAAFAEHNRLVLADGGVPMIGVASLQAALEQTRVATAAQAEVILQASAQDFATAATVFT
FT                   GAANTPLALVPLEDLLGLVEQPNLPSTIDTHPNWRRRLPGPAGTLIEAPTVLARLSALA
FT                   NARNSMS"
     atggatcgca cgaccaacct atccggcacg ccgcgcacgc cgctccagca actggccacc        60
     gatgccgggc tgctggtcga ctgggaagat gctgccagcc ggcccatgcg cgtggccgac       120
     gaggtgctgc gcgccgtgct cttcacgctc ggcctgccgg ccggcacccc ggcccaggtg       180
     tcggaaagcc aggcgcgcct gcgcgcggaa gccgaagcgg tggccatacc gccgctcgtg       240
     accggcgtgg tcgggcaacc gatcgtgctg cagacgtctg cgccccaagc cgcgttgctg       300
     gacggacaac cctatcgtgt tgatttcgag tccgacggca gcaccgaggg caggatcagc       360
     gtcagcgcaa gcgagcacca tgcaacgctg cgcctggcag cggtacaggc cgttggctac       420
     caccgcctga ccatcgacgc cgggccgggc accgtgatcg aagccacgct cgccattgct       480
     cctgcgcgtt gctatggtgt ggccgatgcg ctacgccagc acgatcgccc caccgactca       540
     cgcctgtggg gcgcctccgc acagctctat ggcttgcgat gcgatgcgga acgcgcggcc       600
     agcagcgcag gcctgggcga ctacaccgcc gcgggcacgc tggcgcggca tctctcgcag       660
     cgcggcgcgg atgcgttggc actgagccct gtgcacgcca tgttcacggc cgacccgcgt       720
     cggtattcgc cgtactcgcc atcgagccgc ctgttcctga acgcgtggat gatcgacccg       780
     gccgcgctct ttgggaacga aaccgtacgg caagccgtgg tcgactgcaa cctcgtcgcg       840
     gactatgccc ggctggaagc cgcaccgctc atcgactggc cggccagcgg caacgcccgc       900
     atgacggtgc tgcgcgcgct gcatcggcgc ctgctgcaag caccgctcgg agacaccatc       960
     ggccagacgc tgctggacga ttttcgcgcg tactgcatca atggcggcgc cagcctgcgc      1020
     gaccatgcgc actttgaagc gctgaatgcg caccttgggc ccgcgcattg gaagcagtgg      1080
     cccgcgcagt atcaagatcc gagctacctg ggcgttcagg ccttcgcgcg tgagcatgaa      1140
     gatgcggtga acttccacct cttcctgcaa tgggcggcgg cacgccagtg ggccatcgcg      1200
     cagcgcaccg cggagggcgc cggcatggcc atcggcctcg tcgccgacct ggctgttggc      1260
     accgacagcg caggcagcca cgcgtgggcc cggcaacgcg acttgctgat cggcgtgacg      1320
     gtgggtgcgc cgcccgatgt gttcaacgca cagggccagg gctggggcct gaccaccttc      1380
     agcccgcgtg ccatgcgcac gcaaggcttt tcggccttta tcgagatgct gcgcgcggtg      1440
     atggccgtgc ccggcggtgt gcgcatcgac cacgtgctcg ggctcatgcg gctgtgggtg      1500
     attcccgatg gcgcgcggcc gctcgacggc gtgtacctgc gctacccgat gcaggatctg      1560
     ctgcggctgg tggcgctgga atcgtggcgc aaccgatgca tcgtcattgg cgaagacctg      1620
     ggcaccgtgc ctgctggcct gcgcgacaag ctcgccgacg acggcctgct cggcatgcgc      1680
     atcctctggt tcgagcgcga atacacgcgc gacgatgcgc ccttcaaggc gccgcgcacg      1740
     tgggcgccag cctccgtcgc gatgaccagc acgcacgacc tgcccacgct cgtcggctgg      1800
     tggatcggca acgatctgcg ctggcaagcc cagctcggcc tgctgccggc cggcatgagc      1860
     gagagcgagg cgcacgcgcg ccgcatggac gatcgcgccg cactggttgc cgcctttgca      1920
     gagcacaacc ggctggtgct ggccgatggc ggcgtgccga tgatcggcgt ggcgtcgctg      1980
     caggcggcgc tggaacagac gcgcgtggcc accgcggcgc aagctgaagt catcttgcaa      2040
     gccagcgcgc aggactttgc cacggcagcc accgtgttta cgggcgcggc caatacgccg      2100
     cttgcgctgg tgccgctgga ggacttgctc ggccttgtcg agcagcccaa cctgccgagc      2160
     acgatcgaca cacacccgaa ctggcgacgt cgtctgccag ggccggccgg cacgctgatc      2220
     gaggcaccca cggtgctggc gcgcctgtca gcgctggcca acgcgcgcaa cagcatgtca      2280
     tga                                                                    2283
//

If you have problems or comments...

PBIL Back to PBIL home page