(data stored in SCRATCH zone)

EMBL: CP001069.PE164

CP001069.PE164       Location/Qualifiers
FT   CDS_pept        complement(183167..185008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3935"
FT                   /product="malto-oligosyltrehalose trehalohydrolase"
FT                   /note="KEGG: rso:RS05186 putative maltooligosyl trehalose
FT                   trehalohydrolase protein; TIGRFAM: malto-oligosyltrehalose
FT                   trehalohydrolase; PFAM: glycoside hydrolase family 13
FT                   domain protein; alpha amylase catalytic region; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3935"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29040"
FT                   /db_xref="GOA:B2UHI9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHI9"
FT                   /protein_id="ACD29040.1"
FT                   /translation="MTAPAPRFAHDMPFGATVLADGNTRFRLWAPDATAAWIDIDDTRG
FT                   NESIRMDAEPDGWYAAVAPVGSGTCYRYRLTNRDGVTLSVPDPAARAQWQDIPGPSLVV
FT                   DPQRYRWQHADWQGRPWHETVLYELHVGALGGFKGVRGRLPELARLGITAIELMPVAEF
FT                   PGARNWGYDGVLPFAPDASYGTPDDLKALIDTAHGLGMMVFLDVVYNHFGPDGNYLHHY
FT                   ARSFFRDDVHTPWGAAIDFRKPQVREFFIQNALMWLMEYRFDGLRLDAVHAITERDWLG
FT                   ELAARVRLSAEPGRHVHLVLENEHNAASLLRDGNTHGDFDAQWNDDGHNVLHVLLTGER
FT                   EAYYAAYADAPAQRLARVLQDGFCYQGEPSPIHDNAPRGEPSAHLPPTAFVLFLQNHDQ
FT                   IGNRAFGERLTQLAHPDALHAAQVLLLLSPQIPMLFMGEEWGSTCPFQYFTSHHGMLAE
FT                   AVREGRRREFAKFEAFADPHQRERIPDPNEELTYLASCPGEANLAEPAQLNTLNRMHRL
FT                   LALRHAEIIPRLPHARALDAVALGHAGAIARWRMGDGSVLTLMLNLADQPVAVPTVLAG
FT                   SPADLLHESREGAAAALITHRLPERACVALLHTPSPG"
     atgaccgcac ccgccccccg gtttgcgcac gacatgccgt tcggcgccac cgtcctggct        60
     gacggcaaca cccgcttccg gttgtgggcg cccgacgcga ccgcggcctg gatcgacatc       120
     gacgacacgc gcggcaacga gtccattcgt atggacgccg aacccgacgg ttggtacgca       180
     gcggtggcac ccgtgggctc cggcacgtgc tatcggtacc gcctcaccaa tcgagacggc       240
     gtgacgctgt cagtgcccga ccccgccgca cgcgcacagt ggcaggacat acctggccca       300
     agccttgtcg ttgatccgca gcgttaccgc tggcagcacg ccgactggca agggcggccc       360
     tggcacgaga cggtgctgta cgaactgcac gtcggcgcgc tgggcggttt caagggtgtg       420
     cgggggcggc tgccggaact ggcgcggctg ggcatcacgg ccatcgagtt gatgccggtg       480
     gcggaatttc cgggcgcgcg caactggggc tatgacggcg tgctgccctt tgcgcccgac       540
     gccagctatg gcacgccgga cgacctcaag gcattgatcg acaccgcgca cgggctcggc       600
     atgatggtgt ttctcgatgt ggtctacaac cacttcgggc cggatggaaa ctacctgcac       660
     cactacgcgc gcagcttctt ccgcgacgat gtgcatacgc cctggggcgc cgccatcgat       720
     ttccgcaagc cgcaggtgcg cgagttcttc atccagaacg cgttgatgtg gctgatggaa       780
     tatcgctttg acggcctgcg gctcgacgcc gtgcacgcca tcaccgagcg cgactggctg       840
     ggcgaactcg ccgcccgcgt gcgactgtcg gccgagcctg gccggcatgt gcatctggtg       900
     ctggagaacg agcacaacgc cgcatcgctg ctgcgcgatg gcaacaccca tggcgacttc       960
     gatgcgcagt ggaacgacga cggccacaac gtgctgcatg tgcttctcac cggcgagcgc      1020
     gaagcctatt acgcagccta tgccgatgcg cccgcgcagc gcctggcgcg cgtgctgcaa      1080
     gacggcttct gctaccaggg tgagccgtca cccatccatg acaacgcgcc gcgcggtgaa      1140
     ccaagcgcgc acttgccgcc caccgcgttc gtgcttttcc tgcagaacca cgaccagatc      1200
     ggcaatcgtg cctttggcga acggctgacg cagcttgccc accccgatgc gctgcacgcc      1260
     gcgcaagtgc tgttgctgct gagcccgcag attccaatgc tgttcatggg tgaggaatgg      1320
     ggcagcacct gcccgttcca atacttcacc agccatcacg gcatgctggc cgaagccgtg      1380
     cgggagggcc gccgcaggga gtttgccaag ttcgaggcgt ttgccgatcc gcaccagcgc      1440
     gagcgcattc ccgatcccaa cgaagagctg acctacctcg cctcctgccc cggcgaggcg      1500
     aacctggccg aacccgcaca gctcaacaca ctgaaccgca tgcaccgcct gctggcactg      1560
     cgtcacgcag agatcatccc gcgcctgccc catgcgcgcg cgctcgatgc ggtggcgctg      1620
     ggccacgccg gggccattgc ccgctggcgc atgggcgatg gcagcgtgct cacgctgatg      1680
     ctcaatctgg ccgatcaacc cgtggcggtg cccacggtgc tggcgggcag cccagccgat      1740
     ctgctgcacg aatcgcgcga gggcgccgcc gccgcgctca tcacgcatcg cctgccggag      1800
     cgcgcgtgcg tggcattgct gcacacgcca tcacccggct ga                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page