(data stored in SCRATCH zone)

EMBL: CP001069.PE165

CP001069.PE165       Location/Qualifiers
FT   CDS_pept        complement(185005..187305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3936"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="KEGG: rso:RSp0238 probable glycogen operon protein
FT                   GlgX; TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; SMART: alpha amylase catalytic sub
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3936"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29041"
FT                   /db_xref="GOA:B2UHJ0"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ0"
FT                   /protein_id="ACD29041.1"
FT                   /translation="MLRFPKTLSPGKPFPLGAQWDGLGINFAVFSANASKIELCIFDPA
FT                   GRKELTRFALPECTDEVWHGYLPGVEAGLVYGYRAYGPWEPQHGHRFNPHKLLLDPYAR
FT                   RLVGALRWSDALFGYRLNSNRGDLSFDRRDSAPAMPKAVVTDESFNWGNDIRPNTPWSR
FT                   TVIYEGHVRGMSMLREDLLPPERGTFSALGDSVFIERLQRLGITAIELLPIHAFLQDQF
FT                   LVERGLRNYWGYNTLCFFAPEPSYLSAPSLHELKVAIRRLHAAGIEVLLDVVYNHTCEG
FT                   SELGPTLSFRGLDNASYYRLVPGQERYYINDTGCGNTLNLSHPRVLQMVMDSLRYWVNA
FT                   FHVDGFRFDLGVTLGREGNGFDPGSGFFDAIRQDPVLSTVKLISEPWDVGPDGYQVGNH
FT                   PPGFAEWNDRFRDGIRRFWRGDSGQRPDLAARLTGSGDMFDRRHRRPWASINYVASHDG
FT                   FTLHDLVSYADKHNDANGEDNRDGHNDNCSANWGTEGPTQDPAIQALRERVTRALLATV
FT                   FFSNGTPMLLAGDEFGRTQDGNNNAYCQDNALSWLDWSLLQKDPGQALARYTARLIALR
FT                   KASPALRWPHYVHGNTEILPGVPDIAWFDERGQTLSPDAWNDSEARALALRRACVETID
FT                   AEARPHVALLLINGAATDLTFTLPEPAMDWLLAIDSAAPEQDARPHSGGTLNVAGRSVV
FT                   LLLATQLATIAQIAGQPDADASGETLGHVPDAHNAAQNALQNATPEQPASDDERTAPTA
FT                   GQAASDANGDATR"
     atgctccgct tccccaaaac cctctccccc ggcaaaccct tccccctagg cgctcaatgg        60
     gacggcctgg gcatcaactt cgccgtcttc tccgccaacg ccagcaagat cgagctctgc       120
     atcttcgacc ccgctggccg caaggaactg acccgcttcg ccctgcctga atgcaccgat       180
     gaggtctggc acggctacct gcccggggtg gaagccggcc tcgtctacgg ttaccgcgcc       240
     tacggcccgt gggagccgca gcacggccat cgcttcaacc cccacaagct gctgctcgac       300
     ccctacgccc gccggctggt aggcgcgctg cgctggtccg atgcgctgtt cggctatcgg       360
     ctgaactcca accgtggtga cctttcattc gaccggcgcg acagtgcacc ggccatgccc       420
     aaggccgtgg tcaccgatga gtcgttcaac tggggcaacg atatccgccc gaacacacca       480
     tggtcgcgca cggtcatcta tgaaggacat gtgcgcggga tgtcgatgct gcgcgaagac       540
     ctgctgccgc ccgagcgcgg caccttcagc gcgctgggcg acagcgtctt tatcgagcgc       600
     ctgcagcggc tgggcatcac cgccatcgaa ctgttgccca ttcacgcctt cctgcaggac       660
     cagtttctgg tggagcgcgg cctgcgcaac tactggggct acaacacgct gtgcttcttt       720
     gcgccagagc cgtcgtacct gtcggcgcct tcgctgcatg agctgaaggt ggcgatccgg       780
     cggctgcatg cagccggcat cgaggtgttg ctcgacgtcg tctacaacca cacgtgcgag       840
     ggcagcgagt tggggccgac gctttcgttc cgggggctgg acaacgcgag ctactaccgc       900
     ctcgtgccgg gccaggaacg ctactacatc aacgacacgg gctgcggtaa cacgctgaac       960
     ctgtcgcatc cgcgcgtgct gcagatggtg atggattcgc tgcgctactg ggtcaacgca      1020
     ttccatgtgg atggcttccg ctttgacctg ggcgtcacgc tcgggcgcga gggcaacggc      1080
     ttcgatccgg gctcgggctt cttcgatgcc atacgccagg acccggtgct ctccaccgtc      1140
     aagctgatct ccgaaccttg ggacgtcggc cctgacggct accaggtcgg caaccacccg      1200
     cctggctttg ccgagtggaa cgaccgcttt cgcgatggca tccgccgctt ctggcgtggc      1260
     gattcgggcc agcgcccgga cctcgccgcg cgcctgaccg gcagtggcga catgttcgac      1320
     cgccgccatc gccggccgtg ggcgtcgatc aattacgtgg cctcgcacga cggcttcacg      1380
     ttgcacgacc tcgtgagcta cgccgacaag cacaacgatg ccaatggcga agacaaccgc      1440
     gacggccaca atgacaactg cagcgccaac tggggcaccg aaggccccac ccaggaccct      1500
     gccatccaag ccctgcgaga acgcgtgacg cgcgcactgc tggccacggt gttcttctcc      1560
     aacggcacgc cgatgctgtt ggcaggcgat gaattcggcc gcacgcaaga cggcaacaac      1620
     aacgcctatt gccaggacaa cgccctttca tggctcgatt ggtcgctgct gcagaaagac      1680
     cccgggcagg cgctcgcccg ctatacggcg cggctgatcg cgctgcgcaa ggcaagcccg      1740
     gcgctgcgct ggccgcatta cgtgcacggc aacaccgaga tcctgccggg cgtgccggac      1800
     atcgcctggt ttgacgagcg cggccagacg ctctcacccg acgcgtggaa cgacagcgag      1860
     gcgcgggcgt tggcgctgcg ccgcgcctgc gtcgagacca tcgacgcaga ggcgcgcccg      1920
     cacgtggcgt tgttgctcat caacggtgcg gcgacagacc tgacgttcac gctgcccgag      1980
     ccggccatgg actggctact cgccatcgac agcgcagcgc ccgagcaaga cgctcgacca      2040
     cacagcggcg gtaccctcaa cgtggcaggg cgcagcgttg tgctgctgct cgccacgcag      2100
     ctcgccacga tcgcccagat tgccgggcag cccgatgcag acgccagcgg cgaaaccctc      2160
     gggcacgttc ccgacgcgca caacgcagcg cagaacgcac tgcagaacgc caccccagaa      2220
     caaccggcgt ctgacgacga gcgcaccgcc ccaaccgccg gccaagcagc cagcgatgcc      2280
     aatggagacg ccacgcgatg a                                                2301
//

If you have problems or comments...

PBIL Back to PBIL home page