(data stored in ACNUC7421 zone)

EMBL: CP001069.PE167

CP001069.PE167       Location/Qualifiers
FT   CDS_pept        complement(190200..193694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3938"
FT                   /product="trehalose synthase"
FT                   /note="KEGG: rso:RS05183 hypothetical protein; TIGRFAM:
FT                   trehalose synthase; trehalose synthase-fused possible
FT                   maltokinase; PFAM: alpha amylase catalytic region; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3938"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29043"
FT                   /db_xref="GOA:B2UHJ2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012810"
FT                   /db_xref="InterPro:IPR012811"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ2"
FT                   /protein_id="ACD29043.1"
FT                   /translation="MTRNPTALLVDDALWYKDAVIYQLHVKSFCDSDNDGVGDFPGLIS
FT                   KLDYIAELGVDVIWLLPFYPSPRRDDGYDIAEYRGVHPDYGNMADVRRFIAEAHARGLR
FT                   VITELVINHTSDQHPWFQRARRAKPGSALRDFYVWSDNDKRYAGTRIIFIDTEPSNWTW
FT                   DPVANAYYWHRFYSHQPDLNFDNPRVLKAVIGVMKFWLNLGVDGLRLDAVPYLVEREGT
FT                   SNENLPETHEVLRKIRAAMDGEFKNRLLLAEANQWPEDTQEYFGAGDECHMAFHFPLMP
FT                   RMYMAIAREDRFPITDIMRQTPEVPAGCQWAIFLRNHDELTLEMVTDAERDYLWEVYAS
FT                   DRRARLNLGIRRRLAPLLERDRRRVELMNSLLFSMPGTPVMYYGDEIGMGDNIHLGDRD
FT                   GVRTPMQWSPDRNGGFSRADPEQLVLPAIMGSLYGYESVNVEAQSRDAHSLLNWTRRLL
FT                   ATRKRHRVFGRGSIQFLQPSNRKVLAYIRALEGEAPILCVANLSRASQAVELDLSTFAQ
FT                   RVPVELIGGTAFPPIGQLSYLLTLPPYAFYWLELRENEPGPTWSQPAAEQLPEFTTLVL
FT                   RAGLDALADTRQREAHRQLIEREILPTYLPKRRWFAAKDSVLRSAKFAWGAPVPVDAAS
FT                   TNRPLAGATRPEVFLNEVAVTLGSPDGTERVERYLLPLSIAWESATLPALPIQLALARV
FT                   RRGRHVGYLTDAFTTETFARALLTNLVRGTTLEANDGTVHFEPEPNIAELAEPAGAPEA
FT                   GSTRPAPLPLAPDTPIQWLAAEQSNSSLVIGESVIVKLIRRIATGIHPEVEMTRHLTRV
FT                   GYANTAALIGEVSHHAADGERATLAVMQSFVPNQGDAWTWALDYLRRTIDELAVQMEGV
FT                   TTGDGESSPVAVSEARVDTDEALAGYVNFIGVIGTRLGELHAALAAPTEDPNFGARIAD
FT                   ADDATYWIARVSEQLTRAHDNLTAWQRQNPDSARQPDVQWLLSQHQALLDAARAHAENG
FT                   LGATLSRIHGDFHLGQVLVAQGDAFLIDFEGEPSRPVEERRRKTSPLRDVAGLMRSLDY
FT                   VVGAMRQGPDHVAGPAQERRNVLLERFRAASTERFLEAYAAAIRGPDLNALDQPVVDFH
FT                   LLDLFLLEKAAYEVNYEASNRPTWLPIPLEGFTRVARRLLHAEPPSPAAEDPTGGPP"
     atgacgcgca atccgaccgc gctgctggtg gacgacgcgc tctggtacaa ggacgccgtc        60
     atctatcagc tgcatgtcaa atcgttctgc gattccgaca acgacggcgt cggggacttc       120
     cccgggttga tctccaagct cgactacatt gccgagctgg gggtggacgt catctggctg       180
     ctcccgttct atccgtcacc gcgccgcgac gacggctacg acatcgctga ataccgcggc       240
     gtccaccccg attacggcaa catggccgac gtgcgccgct tcattgccga agcgcatgcg       300
     cggggcctgc gcgtgatcac ggaactggtc atcaaccaca cgtccgatca gcacccgtgg       360
     ttccagcgtg cgcggcgcgc caagccgggc tctgcgctgc gcgacttcta cgtgtggtcc       420
     gacaacgaca agaggtacgc cggcacgcgc atcatcttca tcgataccga gccttcaaac       480
     tggacgtggg acccggtggc caacgcctat tactggcacc gcttctactc gcaccagccc       540
     gatctcaact tcgacaaccc gcgcgtgctc aaggcagtga tcggcgtgat gaagttctgg       600
     ctcaatctgg gcgtggatgg tctgcggctc gatgccgtgc cgtatctcgt ggaacgcgaa       660
     ggcacgtcga acgagaacct gcccgagaca cacgaagtgc tgcgcaagat tcgcgcggcc       720
     atggatgggg aattcaagaa ccgcctgctg ctggccgagg ccaaccagtg gccggaagac       780
     acgcaggaat acttcggtgc cggcgacgaa tgccacatgg cgttccactt tccgctgatg       840
     ccgcgcatgt acatggcgat cgcgcgtgaa gaccgttttc cgatcaccga catcatgcgc       900
     cagacgccgg aggtgcccgc cggctgccaa tgggccatct tcctgcgcaa tcacgacgaa       960
     ttgacgctcg aaatggtgac cgatgccgag cgcgactacc tctgggaggt ctacgcaagc      1020
     gaccgccgcg cgcgcctgaa cctgggcatc cgccgccggc tggcaccgct gctggaacgc      1080
     gaccgccgcc gcgtcgagct gatgaacagc ctgctcttct ccatgcccgg cacgcccgtc      1140
     atgtattacg gcgacgaaat cggcatgggc gacaacatcc acctcggcga ccgcgacggc      1200
     gtgcgcacgc caatgcagtg gtcccccgac cgcaacggcg gcttctcgcg cgccgacccc      1260
     gaacagctcg tgctgccggc catcatgggc tcgctgtacg gctatgaatc ggtgaacgtg      1320
     gaagcgcaga gccgcgacgc gcattcgctg ctgaactgga cgcgccggct gcttgccacg      1380
     cgcaagcggc atcgcgtgtt cggccggggt tccatccagt ttctgcagcc gtccaaccgc      1440
     aaggtgctgg cgtatatccg cgcgctcgaa ggcgaagcgc cgatcctgtg cgtggcgaac      1500
     ctctcccgcg cctcgcaggc tgtggagctg gatttgtcca cctttgcgca gcgggtgccg      1560
     gtggagctga ttggcgggac ggcgtttccg cccatcggcc agttgtcgta tctgctcacg      1620
     ctgccgccct acgccttcta ttggctggag ctgcgcgaga acgagcctgg cccgacctgg      1680
     tcgcaaccgg ctgccgagca attgcccgag ttcacgacgc tggtgctgcg cgcagggctg      1740
     gatgccctgg ccgatacgcg acagcgcgag gcacaccgcc agttgatcga acgcgaaatc      1800
     ctgccaacct atctgcccaa gcgccgctgg tttgccgcca aggacagtgt gctgcgtagc      1860
     gcaaagtttg cctggggcgc ccccgtgccg gtggatgccg catccaccaa ccgcccgctg      1920
     gccggggcaa cgcggcccga ggtgttcctc aacgaagtgg ccgtcacgct gggcagcccc      1980
     gacggcaccg agcgcgtcga gcgctacctg ctgccgcttt ccatcgcatg ggaatcggcc      2040
     acgctgccgg ctctgcccat tcagctcgcc ctggcgcgcg tgcggcgcgg ccgccatgtc      2100
     ggctacctga ctgacgcctt caccaccgag accttcgccc gggcgctgct caccaacctc      2160
     gtgcgcggca ccacgctgga agccaatgac ggcaccgtgc atttcgagcc tgaaccgaac      2220
     atcgcagagc tggccgaacc tgccggggcg cctgaagccg gcagcacacg gcctgcgccg      2280
     ctgccgctgg cacccgacac gcccatccag tggctggcgg ccgagcaatc gaacagctcg      2340
     ctggtgattg gcgagtccgt tatcgtcaag ctgatccgcc gtatcgcaac gggcatccac      2400
     cccgaggtgg agatgacgcg acacctcacg cgcgtgggct acgccaacac ggcggcactc      2460
     atcggcgaag tctctcacca cgctgccgac ggcgaacgcg ccacgctggc cgtcatgcag      2520
     agcttcgttc ccaaccaggg cgatgcctgg acgtgggcac tggactacct gcgacgcacc      2580
     atcgacgaac tggccgtgca gatggaaggc gtgaccacgg gcgatggtga atcgtctccg      2640
     gtggcggtct cggaagcgcg cgtggatacc gacgaggcgt tggccggcta cgtcaacttc      2700
     atcggcgtga tcggcacgcg gctgggcgaa ttgcatgccg cgctggcggc gcccaccgaa      2760
     gacccgaact tcggcgcgcg cattgcagat gccgacgatg ccacctactg gatcgcccgc      2820
     gtgagcgagc agctgacccg cgcgcatgac aacctgacgg catggcaacg gcaaaatccc      2880
     gacagcgcac ggcaacccga cgtgcaatgg ctgctgtcgc aacaccaggc gctgctcgac      2940
     gccgcccgcg cgcatgccga aaacggcctg ggcgcaacgc tctcgcgcat ccatggcgat      3000
     tttcacctcg gccaggtgct ggtggcgcag ggcgatgcct tcctgatcga ctttgaaggc      3060
     gagccctccc gccccgtgga agaacgccgg cgcaagacca gcccgctgcg cgacgtggcg      3120
     gggctgatgc gctcgctcga ctacgtggtg ggcgccatgc gtcagggccc cgatcatgtg      3180
     gccgggcccg cgcaggagcg ccgcaacgtc ctgctggagc ggttccgcgc tgcgtccacc      3240
     gaacgcttcc tggaggcgta tgccgctgcc attcgcgggc ccgatctgaa cgcgctggat      3300
     cagcccgtgg tcgactttca cctgctcgat cttttcctgc tggaaaaggc cgcatacgaa      3360
     gtcaactacg aagcgtccaa ccgcccgacc tggctgccga ttccgctgga aggcttcaca      3420
     cgcgtggcac gccgcctgct gcatgcagag ccaccatcac ccgctgcaga agacccgacg      3480
     ggaggcccac cgtga                                                       3495
//

If you have problems or comments...

PBIL Back to PBIL home page