(data stored in ACNUC7421 zone)

EMBL: CP001069.PE168

CP001069.PE168       Location/Qualifiers
FT   CDS_pept        complement(193691..197281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3939"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: rso:RS05182 putative
FT                   alpha-amylase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3939"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29044"
FT                   /db_xref="GOA:B2UHJ3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ3"
FT                   /protein_id="ACD29044.1"
FT                   /translation="MPETKSPKPATSRKTTAALKAAKPPGSKAKSATKPTAMPSERPPA
FT                   ATQPPYAPAICYVHPLQLGRLDRWDGVLDRIASLGFDHVLMAPPFAVGAAGNVFVTRDH
FT                   AQLHAALGGGPADAALATLAEGCRARGLTLQLDLVIDRVAIDAPLRADHPDWFASHAED
FT                   GDALDPRLPPSHLEVASFRHDDPRCADAILMWWTQQLRAWAALGIGGFRCEAPARLPAA
FT                   RWRTLIADVRKDVGVIRFLAWTPGMDGAAVDALAGAGFDATFSSLRWWDFRAGWMVEEH
FT                   ARLAAVAPPIAAVEAPFGTRYGQAFGDAMIRERAYRRLLHVADTLDAGWLMPLGFERGA
FT                   LLPMLAERGDPSDQQWIDAHAAFDLSDAVRDVNATIRAARETNTVAPHAELRMLTGPDA
FT                   PATALLRADGPDLRAGDAATLTVINPDLYMGVSVHADHFLPGVAGGFTRGVALDLLTEP
FT                   VGSCDDTLRARARPLAEIDLLPGDVQVWRVFRNAPVRTPAAVKPAKSLRTKAGEAKEPV
FT                   NAAIASPRIGIEQVQPSVEDGRFAVKRLVGDDIIVEADVLMDGHDKLAVHLLWRAQDED
FT                   TWQHVPMMPLGNDRWRGAFRPERLGRHVYAVAAWRDAFGTYRSELEKKHTAGVEVTLEL
FT                   EEGARLVALAAEHAPNDAPVDALHKLARLLAEADQAHRLKLLLDPVTEHVMAQASHYRP
FT                   FYVESVAYPLDVERAGAAFASWYKLFPRSASDDEQRHGTFDDVIRRLGAIRGMGFDVLY
FT                   FPPIHPIGRTNRKGRNNSLRAEPDDPGSPYAIGATEGGHDAIHPQLGTLEDFRRLMRAA
FT                   REKGLELALDFAIQCSPDHPWLREHPGWFAWRPDGSIKYAENPPKKYEDIVNVDFYADD
FT                   AKPGLWTALRDVVMFWADEGVRLFRVDNPHTKPLPFWEWMIGEVRARYPDTVFLSEAFT
FT                   RPKVMYRLAKVGFSQSYTYFTWRHTKQEFIDYLTELTRTPVREYFRPHFFVNTPDINPV
FT                   FLQTSGRPGFLIRAALAATLSGLWGVYNGFELCEGAAVPGKEEYLDSEKYQLRAWDHNR
FT                   PGNIVKEIALLNRIRRANPALHSHLGVTFQPASGDRILFFSKSTPPVLPAQLETSQAEP
FT                   ANALSPDRFGDNTVFVAINLDPHHAHESDIELPLWQWGLPDHGALMAENLVNGQRTVWR
FT                   GKWQHIRLEPEHPFAIWRVRPALPSEEQPS"
     atgcccgaga ccaagtcgcc caaacccgcc acttcacgga aaaccacggc cgcattgaag        60
     gcggccaagc cacccggcag caaagccaaa tcggcaacca agccgacagc gatgccgagc       120
     gaacgcccgc cagctgcgac gcagcccccg tatgccccgg ccatctgcta cgtgcatccg       180
     ctgcaactcg gcaggctcga ccgctgggac ggcgtgctcg atcgcattgc ttcattgggc       240
     tttgatcatg tgttgatggc cccgccgttt gcggtgggtg cggccggcaa cgtcttcgtc       300
     acgcgagacc atgcgcaact gcatgccgca ttgggcggtg ggccggccga cgccgccctc       360
     gccaccctgg ccgaaggctg ccgcgcgcgc gggcttacgt tgcagctcga tctggtgatc       420
     gaccgcgtgg ccattgatgc gccgctgcgt gccgaccacc ccgactggtt cgccagccac       480
     gccgaagacg gcgacgcgct cgacccacgc ctgccgccgt cgcacctgga ggtcgcctcc       540
     ttccgacacg acgacccgcg ctgcgccgac gccatcctga tgtggtggac gcagcagttg       600
     cgtgcgtggg ccgcattggg catcggcggg ttccgctgcg aagcgcctgc acgcctgcca       660
     gcggcacgct ggcgcacatt gattgccgac gtgcgcaaag acgttggcgt catacgcttc       720
     ctggcgtgga cgcccggcat ggatggcgca gcggtcgatg cgctggcagg tgccggcttt       780
     gacgcaacgt tctcgtcgct gcgctggtgg gatttccgcg ccggttggat ggtggaagag       840
     cacgcccgcc tggctgccgt ggccccgccc atcgccgcag tggaagcacc gttcggcacg       900
     cgctacggcc aggcatttgg cgacgcgatg atccgcgaac gcgcctaccg ccgtctcctg       960
     cacgtggccg acacgctcga tgccggctgg ctgatgccgc tgggcttcga acgcggcgca      1020
     ctgctgccga tgctggccga gcgcggtgac ccatccgacc agcaatggat tgacgcgcac      1080
     gccgcgtttg acctgagcga cgcggtgcgc gatgtgaatg cgaccatccg cgccgcacgc      1140
     gagacgaaca ccgtcgcacc acatgccgaa ctgcgcatgc tgaccggccc agacgcaccc      1200
     gccaccgccc tcttgcgcgc cgatggcccg gacctgcgcg caggcgatgc cgccacgctg      1260
     acggtcatca accccgacct gtacatgggt gtgtcggtgc atgccgacca ctttctgccc      1320
     ggcgtggccg gcggctttac gcgcggcgta gcgctcgatc tgttgacgga gcccgtcggc      1380
     agttgcgacg acacgctgcg cgcccgggca cggcccttgg ccgagatcga tttgctgccc      1440
     ggcgacgtgc aggtctggcg cgtgttccgc aatgctccgg tgcgcactcc cgcagcggtc      1500
     aaaccggcca agagcctgcg caccaaggcc ggcgaagcga aggaacctgt caacgctgcc      1560
     attgcctcgc cgcgcatcgg catcgaacag gtgcagccct ccgttgaaga cggacgcttt      1620
     gccgtgaagc gcctggtggg cgatgacatc atcgtcgagg ccgatgtgct gatggacggg      1680
     cacgacaagt tggccgtgca cctgctgtgg cgcgcgcaag atgaagacac gtggcagcac      1740
     gtaccgatga tgccgctggg caacgaccgc tggcgtggcg cgttccggcc cgagcggctg      1800
     gggcggcacg tgtacgccgt ggccgcttgg cgcgacgcgt tcggcaccta ccggtccgaa      1860
     ctggagaaga agcacaccgc cggcgtggag gtgacgctgg agctggaaga aggcgcgcgg      1920
     ctcgtcgcac tggcggccga gcatgcgccc aacgacgcac cggtcgacgc gctgcacaag      1980
     ctggcccgcc tgttggcgga ggcagaccag gcgcaccggc tcaagctatt gctcgacccg      2040
     gtgaccgagc acgtgatggc gcaggcctcg cactaccggc cgttctatgt cgaaagcgtg      2100
     gcgtacccgc tcgacgtgga acgcgctggc gcggcattcg ccagctggta caaactgttc      2160
     ccccgctcgg catcggacga tgaacagcgg catggcacgt tcgacgatgt gatccgccgc      2220
     ttgggcgcca ttcgcggcat gggcttcgac gtgctgtatt tcccgcccat ccaccccatc      2280
     ggccgcacga atcgcaaagg ccgcaacaac agcctgcgcg cggagcccga cgaccccggc      2340
     agcccatacg ccattggtgc caccgaaggc gggcacgacg ccatccaccc gcagctcggt      2400
     acgctggaag acttccgccg cctgatgcgc gccgcgcgtg agaagggcct ggagctggca      2460
     ctggactttg ccattcaatg ctcgcccgac cacccctggc tgcgcgagca ccccgggtgg      2520
     tttgcatggc gcccagacgg cagcatcaaa tacgcagaga acccgcccaa gaagtacgaa      2580
     gacatcgtca acgtcgactt ctatgccgac gacgccaagc ccggcctgtg gaccgcactg      2640
     cgcgatgtgg tgatgttctg ggccgacgag ggcgtgcgcc tgttccgcgt cgacaatcca      2700
     cacaccaagc cgctgccgtt ctgggaatgg atgatcggcg aggtgcgtgc gcgctatccg      2760
     gatacggtgt tcctgtcgga agcctttacg cgccccaagg tgatgtaccg gctggcgaag      2820
     gtgggcttct cgcagtcgta cacgtacttc acgtggcggc acaccaagca ggaattcatc      2880
     gattacctga ccgagttgac gcgcacgccg gtgcgtgagt atttccgccc gcacttcttc      2940
     gtcaacacgc ccgacatcaa cccggtgttc ctgcagacat cggggcggcc gggtttcctg      3000
     attcgtgcag cgctggcggc cacgctgtcc ggcctgtggg gcgtctataa cggcttcgag      3060
     ctgtgcgaag gcgctgcggt gcccggcaag gaggagtacc tcgactccga gaagtatcaa      3120
     ctgcgcgcgt gggaccacaa ccgccccggc aacatcgtca aagagattgc gctgctcaac      3180
     cgcatccgcc gggccaatcc ggcgctgcac tcgcacctgg gcgtgacgtt ccagcccgcc      3240
     tcgggcgacc ggatcctgtt cttcagcaaa tcgacgccgc ccgtgctgcc ggcgcagctg      3300
     gaaacctcgc aggccgaacc ggccaacgcc ctgtcgccgg atcgctttgg agacaacacg      3360
     gtgttcgtgg cgatcaacct cgacccgcac cacgcgcacg aatccgacat cgaactgcca      3420
     ctgtggcaat ggggcctgcc cgaccacggc gcgctgatgg ccgagaacct ggtcaacggc      3480
     cagcgcaccg tgtggcgcgg caagtggcag cacatccgtc ttgaacccga gcatccgttt      3540
     gccatctggc gcgtgcgccc ggccctgcca tcggaggaac aaccgtcatg a               3591
//

If you have problems or comments...

PBIL Back to PBIL home page