(data stored in ACNUC7421 zone)

EMBL: CP001069.PE169

CP001069.PE169       Location/Qualifiers
FT   CDS_pept        complement(197313..198944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3940"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   PFAM: glycosyl transferase group 1; Starch synthase
FT                   catalytic domain protein; KEGG: rso:RSp0242 glycogen
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3940"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29045"
FT                   /db_xref="GOA:B2UHJ4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ4"
FT                   /protein_id="ACD29045.1"
FT                   /translation="MTLSLNVLFVASEAVPLAKTGGLGDMVGACANALRRAGMKVTVML
FT                   PGYPDAITQLQHTRTVCEWTDLPGGPARLLSGHMGAQGIPVLLFDAPALFARPGNPYLD
FT                   AHGEPYEDNALRFASFSQAAARVAGGVPGVHRSDTVQAHDWHAGLVPLFVKRAQAPVKT
FT                   VFTIHNLAFQGNFPMHVVPDIGVPPDAAHEAEFWGQFSFLKAGLLWADRITTVSHAYAR
FT                   EILTDTAGCGMQDLLRARQRDLIAILNGIDNDVWNPSKDPLLPQPFVASNLSGKHTAKR
FT                   VLQQRFGLPEDAKAPLLAVGSRLTHQKMADVTLQALPQLLESNPQLQVAVLGCGEHAYE
FT                   TGMADLAARYPRQVAAKIGYTEAFAHLLHAGADILLHGSRFEPCGLTPLYSMRYGTVPV
FT                   ASRVGGLMDTITDRGSPEAALHGATGFLFDGDTADAMVAAVERALHVFAQPQAWRILQY
FT                   NGMTTDFGWSQPAREYIALYRTLVPAATPMPAVALVQAPVAPDAVHTPRPEQPVRTPAR
FT                   RRSTALSDEIRAHAVARAASAEKIRA"
     atgaccttgt cgctgaacgt tctcttcgtc gcttctgaag ctgtgccgct ggccaagacc        60
     ggcgggcttg gagatatggt cggggcctgc gcgaacgcac tgcgccgcgc cggcatgaaa       120
     gtgacggtga tgctgccggg ctatcccgac gccatcacgc agttgcagca cacccgcacg       180
     gtgtgcgagt ggaccgacct gcccggtggc cccgcacgcc tgttgagcgg gcacatgggc       240
     gcgcaaggca tcccggtact gctgttcgac gcgccggcac tgttcgcgcg gccgggcaac       300
     ccatatctgg atgcacatgg cgagccctat gaagacaatg cgctgcgctt tgcgtcgttc       360
     agccaggccg ctgcgcgcgt tgccggcggc gtacccgggg tgcatcgctc tgacaccgtg       420
     caggcgcatg actggcacgc ggggctggtg ccgctgttcg tcaagcgcgc gcaggcgccg       480
     gtgaagaccg tcttcacgat ccataacctc gcgttccagg gcaatttccc gatgcacgtg       540
     gtgccggaca ttggcgtgcc gcccgatgcc gcgcatgaag ccgagttctg gggccagttc       600
     agcttcctga aggccggcct gctttgggcc gatcgcatca ccaccgtgag ccacgcgtat       660
     gcgcgcgaaa tcctgaccga cacggcgggt tgcggcatgc aggacctcct gcgcgcgcgc       720
     cagcgagacc tcatcgccat cctcaacggc atcgacaacg atgtgtggaa cccgtcgaaa       780
     gacccgctgc tgccgcagcc gtttgttgct tccaacctga gcggcaagca caccgccaag       840
     cgcgtgctgc agcagcgctt tggcctgccg gaagacgcca aagcgccgct gctggccgtc       900
     ggcagccgcc tgacgcatca gaagatggcc gacgtgacgt tgcaggcgct gccgcaattg       960
     ctggaatcca acccgcaatt gcaggtggcg gtgctcggct gcggagagca cgcctacgag      1020
     accggcatgg cggacctggc ggcgcgctat ccgcgccagg tggccgcaaa aatcggctac      1080
     accgaggctt ttgcccacct gctgcacgcc ggcgccgata tcctgctgca tggcagccgc      1140
     ttcgagccgt gcggcctgac gccgctctat tcgatgcgct atggcacggt gcccgtcgcg      1200
     tcacgcgtgg gcgggctgat ggacaccatc accgatcgtg gctcgcccga agcggcgctg      1260
     cacggcgcca cgggtttcct gtttgacggc gacaccgccg acgccatggt cgccgcagtg      1320
     gagcgtgcgt tgcacgtctt tgcccagccg caggcgtggc gcatcctgca atacaacggc      1380
     atgacgaccg acttcggctg gtcgcagcct gcccgcgaat acatcgcgct gtatcgcacc      1440
     ctggtgccgg ccgctacgcc catgcccgct gtggcgctgg tgcaagcgcc cgtcgcaccg      1500
     gacgctgtgc acacgccccg ccccgaacaa cctgtgcgta cgccggcgcg gcgacgctcg      1560
     acggcgctgt ccgacgagat ccgagcgcac gcggtggcgc gcgccgccag tgccgaaaag      1620
     atccgtgcct ga                                                          1632
//

If you have problems or comments...

PBIL Back to PBIL home page