(data stored in ACNUC7421 zone)

EMBL: CP001069.PE172

CP001069.PE172       Location/Qualifiers
FT   CDS_pept        complement(201688..202575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3943"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pap:PSPA7_2742 probable
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3943"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29048"
FT                   /db_xref="GOA:B2UHJ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHJ7"
FT                   /protein_id="ACD29048.1"
FT                   /translation="MIDLVLLRSFVTVVDTGNFTRAAEHLHLTQSTVSQQILRLEQQLD
FT                   CRLLDRSQRQVLPTEEGDRLLGYARRLLRLANEASEALSPEHTGGVLRLGVPEDLGSGA
FT                   LMPLIASFARERPRLRLEVESGLSHHLLRLYRNGDLDMLLVKQWGTDSDCHARWAEPVC
FT                   WIDSAERPHTLPLGPSQPSLPLVVFPVGALYRQEMLHALESIGQPWRITYSSPSLASLC
FT                   AAVSAGLGVSLLPASTVQAGHRVLGAADGFPEIGGLELALFARPDLDSAGRALRDRLVE
FT                   MCAARAQALQSAAG"
     atgatcgatc ttgtcttgct gcgcagcttt gtcacggtgg tcgatacggg caacttcacg        60
     cgcgcggccg agcatttgca cctgacgcaa tcgaccgtca gccagcagat cctgcggctt       120
     gagcagcagt tggactgccg cctgctcgac cgcagccagc gccaggtact gccgacggaa       180
     gaaggcgacc gcctgctcgg ctacgcgcgc cgcctgctgc gcctggccaa cgaagccagc       240
     gaggcgctca gccccgaaca caccggcggc gtgctgcgcc tgggcgtgcc ggaagacctt       300
     ggcagcggcg cgctgatgcc gctcatcgcc agctttgcgc gcgagcgccc gcggctgcgc       360
     ctcgaggtgg aaagcggcct atcccaccac ctcctgcgtc tgtatcgcaa tggcgacctc       420
     gacatgctgc tcgtcaagca atgggggacc gacagtgact gccatgcgcg ctgggctgag       480
     ccagtttgct ggatcgacag cgccgagcgg ccgcacacgc tgccgctcgg gccatcgcaa       540
     ccttcattgc cgctggtggt gtttccggtg ggcgccctgt atcggcagga gatgctgcat       600
     gcgctggaat cgatcggcca gccgtggcgc atcacatatt caagcccgag cctggcgagc       660
     ctgtgtgctg ccgtcagcgc ggggctgggc gtgagcctgc tgccggccag caccgtgcag       720
     gccgggcatc gcgtgctcgg ggctgcggat ggttttccgg agatcggcgg gctggagctg       780
     gcgctgtttg cgcggcccga cctcgacagc gcggggcgtg cgctgcggga tcgccttgtc       840
     gagatgtgcg ccgcgcgtgc gcaggcgctg caatctgccg ccggctga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page