(data stored in SCRATCH zone)

EMBL: CP001069.PE175

CP001069.PE175       Location/Qualifiers
FT   CDS_pept        complement(204023..204328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3946"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3946"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29051"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK0"
FT                   /protein_id="ACD29051.1"
FT                   /translation="MTEELLVQLIAEVEKEDPVDFANLPFDEQMLRDLVCKLVSRQLTQ
FT                   MEKAHFSQDEVIVSLTASIAKLVLENLVLNARLLAQQGHGESARALLERISRQAKG"
     atgaccgaag agttgctggt ccagttgatt gcggaagtcg agaaggaaga cccggtggat        60
     ttcgccaacc tgccctttga cgagcagatg ttgcgcgacc tggtctgcaa gctggtgtca       120
     cgccagctga cgcagatgga aaaagcccac ttcagccagg acgaggtgat cgtctcgctc       180
     acggcgagca tcgccaagct ggtcctcgaa aatctggtgc tgaatgcgcg cctgctggca       240
     cagcaggggc acggcgaaag cgcacgcgcg ctgctggagc ggatctctcg tcaggcgaag       300
     ggataa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page