(data stored in ACNUC7421 zone)

EMBL: CP001069.PE179

CP001069.PE179       Location/Qualifiers
FT   CDS_pept        207660..211211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3950"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: rso:RS03712 probable transmembrane protein;
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; EAL domain protein;
FT                   histidine kinase HAMP region domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3950"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29055"
FT                   /db_xref="GOA:B2UHK4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK4"
FT                   /protein_id="ACD29055.1"
FT                   /translation="MPKHAFFPTTLRGRLLALAAVAALPAIVVAIAGVALYRDRLNDHL
FT                   AQHLTHETETAAARVGMVLSNANTLLSVLIADDSALRMERQECSSFVNRVFHNQSELAN
FT                   LGIIDAHRKLVCTPDTAKLAIDLSDRPYINEIMATGRPSLSTFVIGRVSGQAVLISARP
FT                   MAGNDGTIRGVAYAAVRQSALIAAAVDGMSEAPVYLVDAAGNVLSTHGALEAAQVPAIV
FT                   RGPLVAAAAQQPGEPVFVDDTDGVRRAYAAMVVPHAAGGHLRIVRGVDATDIVRQQRNV
FT                   TLAGGGAILLMVVMLLALIQMALRRMVMPRIDALVDAARHYATGDFSARVPEHGSSRDE
FT                   LSLLERTFNEMRAAIQRHDATVHRLTERFQRVARATNDWIFDWDIATGESWANASLHRL
FT                   LGSDALLGQGDDDGTGGGTSRTLTFQQFVHPDDVDAFAHELRTVLNSDRDSWQHVCRVI
FT                   DANRATRTVEIRASLYRDQDGRAVRMVGGVTDISQRSAIEQELRSSEANLRVAEQIALL
FT                   GSWRWDVLRDSTTWSSGMYVLTGMPPGAPPAFAQQAQFFTADSYNRLREAASRAVTEGE
FT                   AYSLELEMIRRDGEHRWVLSRGNIERNDRDEVVALFGTMQDITDRRESDEQLRLLRRVV
FT                   ESVPSGITVADAQQPDFPIVYVNPGFERMTGYRAEEILGRNARFLHSSEPGQPALNEVR
FT                   TALRDESEIRVLLRNFRKDGHAFLNNFLLSPVRDAKGAVTHYVGIQDDVTEQEMTRTRL
FT                   AQHATIDSLTGLPNRTLLADRVQQSVEMAARQRSRFYVALVNIDRFKVVNDSLGHLLGD
FT                   EVLRRVAERLRDAADTVDTVARFGGDVFALVISHAGSRGVDFGFDLFAEPVRVEGHEVF
FT                   VTASIGVAEYPAHGADADSLIRHAEMAMYYAKQNGRNRLEFFAPEMDIGVSYRLNLEHQ
FT                   IRATLEQGQFRLLYQPQIDTKTGRVCGLEALIRWIHPTRGLLPPAAFIPVAEESGLIVE
FT                   IGNWVLTEAARQRAEWHKRGLADDLTLAVNVSPLQFKRGTVLPTLLKLQRQYGLGSGFL
FT                   ELEVTESMLMEGTERTIEDLTAIRQLGVRIAIDDFGTGYSSLAYLKRLPIDLIKIDRAF
FT                   VKDIDRDSNDAAICTTVVVLAHNLGVKVCAEGVEDAAQSAFLASHQCDVLQGYYFSEPL
FT                   LPEAVTALLERNTRFTL"
     gtgccgaagc acgctttctt tcccaccacg ctgcgcggcc gcttgcttgc cctggccgcg        60
     gtggccgcct tgccggccat tgttgtcgcg attgctggtg tggcgcttta tcgtgaccgg       120
     ctcaatgatc accttgccca gcacctgacc cacgaaaccg agactgccgc tgcgcgcgtc       180
     ggcatggtgc tgtccaacgc caatacgctg ctctcggtgc tcatcgcgga cgattcggcg       240
     ctgcgcatgg agcggcaaga gtgcagcagt ttcgtcaacc gcgtctttca taaccagagc       300
     gaactcgcga acctcggcat catcgacgcg catcgcaagc tggtatgtac gcccgatacg       360
     gcgaagcttg ccatcgatct gtcggaccga ccgtacatca acgagatcat ggcgacgggc       420
     cgaccgtccc tgtcgacatt tgtgatcgga cgcgtctccg gccaggcagt gttgatttcg       480
     gcgcggccga tggcaggcaa cgacggcacc atccggggcg tggcgtacgc ggccgtgcgg       540
     cagagcgcgt tgattgcggc ggccgtcgac ggcatgtcgg aggcgccggt ctacctcgta       600
     gatgcggcgg gcaacgtgtt gtcgacccac ggtgctctgg aggccgccca ggtgccggcc       660
     attgtgcgcg ggccgctggt ggccgctgcg gcccagcagc caggcgaacc ggtgttcgtg       720
     gacgacaccg acggcgttcg ccgcgcctac gccgccatgg tggtgccgca cgcggccggc       780
     gggcatttgc gcatcgtgcg cggcgtggac gctaccgaca tcgttcgcca gcagcgcaac       840
     gtgacgctgg ccggcggcgg cgccatcctg ctgatggtgg tgatgctgct ggcgctcata       900
     cagatggcgc tgcggcggat ggtcatgccg cgcattgatg cgctggtgga tgcggcccgc       960
     cactacgcaa cgggcgattt ttccgcccgc gtgcccgagc acggctcctc gcgcgatgaa      1020
     ctctcgctgc ttgagcgcac cttcaacgaa atgcgtgccg ccatccagcg ccacgacgcc      1080
     accgtccacc gcctgaccga acgcttccag cgcgtggcgc gcgccaccaa cgactggatc      1140
     ttcgattggg atatcgccac cggcgagtcc tgggccaacg ccagcctgca tcggctgctt      1200
     ggcagcgacg cgttgctggg ccagggcgac gacgacggta caggtggagg tacctcgcgc      1260
     acgctgacat tccaacagtt cgtgcacccg gacgacgtcg acgccttcgc gcacgagctg      1320
     cgcactgtat tgaattcgga ccgcgacagc tggcagcacg tctgccgggt gatcgatgcc      1380
     aaccgtgcca cgcgcacggt ggagattcgc gcaagccttt atcgtgatca ggacggccgc      1440
     gccgtgcgca tggtcggcgg ggtgaccgac atttcgcagc gctcggcaat cgagcaggaa      1500
     ctgcgcagca gcgaagcgaa cctgcgtgtg gcggaacaga ttgcgctcct gggcagttgg      1560
     cgctgggacg tgctgcgcga ctcgaccacg tggtcgtcgg gcatgtacgt gttgactggc      1620
     atgccgccgg gtgcgccgcc ggcctttgcg cagcaggcgc agttctttac cgctgacagt      1680
     tataaccgtc tgcgcgaagc cgccagccgt gccgtgaccg aaggtgaggc gtactcgctg      1740
     gagctggaga tgatccgccg cgacggcgag caccgctggg tgctttcgcg cggcaacatc      1800
     gagcgcaacg atcgcgatga ggtcgtcgcc ttgttcggca ccatgcagga catcacagat      1860
     cggcgcgaat cggacgagca actgcggttg ctgcgccgcg tggtcgaatc ggtgccgtcc      1920
     ggcattactg tggccgacgc acagcagccc gactttccga tcgtgtacgt gaaccccggc      1980
     ttcgagcgca tgacgggcta tcgcgcagag gaaattctgg gccgcaacgc gcgcttcctg      2040
     cattcgtccg agcctgggca gccggcgctg aacgaagtgc gaaccgcgct gcgcgacgag      2100
     agtgagatcc gcgtgctgct gcgcaatttc cgcaaggacg gccacgcctt cctgaataac      2160
     ttcctgctct cgcccgtgcg tgatgccaag ggtgcggtca cgcattacgt cggcattcag      2220
     gacgacgtga ccgagcagga gatgacgcgc acgcgcctgg cgcagcacgc caccatcgat      2280
     tcgctcacgg gcctgcccaa ccgcacgctg ctggctgacc gcgtgcagca gtcggtggag      2340
     atggccgcac gccagcgtag ccgcttctat gtggcgctcg tcaacattga ccgtttcaag      2400
     gttgtcaacg acagccttgg ccacctgctg ggcgacgagg tgctgcgtcg tgtggccgag      2460
     cgcctgcgcg atgcggccga tacagtggac accgtggcgc gttttggcgg cgacgtgttt      2520
     gcactggtga tctcgcacgc gggttcgcgc ggtgtcgatt tcggctttga cctgtttgcc      2580
     gaaccggtgc gcgtggaagg gcacgaggtg ttcgtgacgg cgagtattgg cgtggccgaa      2640
     tacccggcgc acggcgcaga cgccgatagc ctcatccgcc acgccgagat ggcgatgtac      2700
     tacgccaagc agaacggccg caatcggctg gaatttttcg cgccggagat ggacatcggc      2760
     gtgtcgtacc ggctgaacct ggagcaccag attcgtgcta cgctggagca ggggcagttc      2820
     cgcttgctgt accagccgca gatcgacacc aagaccggcc gcgtgtgcgg gctggaagcg      2880
     ctgatccgct ggattcatcc gacacgcggg ttgctgccgc cggccgcgtt cattccggtg      2940
     gccgaagaga gcgggctgat tgtcgagatc ggcaactggg tcttgaccga ggccgcgcgg      3000
     cagcgcgccg agtggcacaa acgcggcctg gccgatgacc tgacactggc tgtgaacgtg      3060
     tcgccgctgc agttcaagcg cggcaccgtg ctgccgacgc tgctcaagct gcagcgccaa      3120
     tatggcctgg gctccggctt ccttgaactg gaagtgaccg agtcgatgct gatggaaggc      3180
     accgagcgca ccatcgaaga cctcacggcc attcgacagc ttggcgtgcg cattgccatc      3240
     gacgacttcg gcacggggta ttcgagcctg gcgtatctga agcgcttgcc gatcgacctc      3300
     atcaagatcg accgcgcgtt cgtcaaggac atcgatcgag attccaacga tgccgcgatc      3360
     tgcaccaccg tcgtggtgct ggcccacaac cttggcgtga aggtgtgcgc cgaaggtgtg      3420
     gaagacgctg cgcagtcggc ctttctggcc tcgcaccaat gcgacgtgct gcagggctat      3480
     tacttcagcg agccgctgtt gcccgaggcg gtgacggcat tgctggagcg caacacgcgc      3540
     ttcacgctgt aa                                                          3552
//

If you have problems or comments...

PBIL Back to PBIL home page