(data stored in SCRATCH zone)

EMBL: CP001069.PE18

CP001069.PE18        Location/Qualifiers
FT   CDS_pept        complement(17929..18711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3778"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_4033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3778"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28894"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH43"
FT                   /protein_id="ACD28894.1"
FT                   /translation="MKMQIKKIAAVLLLGSLGMLAACGGGSDDIGQIIGTSSPQYRTMH
FT                   VNPFIGNVDFGVNGTTRIANVGFKNVSNYFGIDAVATTATVSNAGSATPLASANFNPAN
FT                   GHRYTALAIVGATASATSLAIIDDPYDKSILSDKARVRTFNAAYNAPNVDVYVTAPNAD
FT                   ISAVPPTMGGAAYGSASPASTQDSIYVDGGTYEIRVTTAGTKSVIFASQPFSLANNADW
FT                   LITTLPAGGAGTVTPNAIRVLVAQANGASQTASELPAQ"
     atgaagatgc agatcaagaa gatcgcagcc gtgctgctgt tgggttcgct cggtatgctc        60
     gcggcgtgtg gcggcggcag tgatgacatt ggccagatca tcggtaccag ctcaccgcag       120
     taccggacga tgcacgtcaa tccattcatt ggtaacgtgg acttcggggt caacggcacc       180
     accaggatcg ccaatgtcgg cttcaagaac gttagcaact atttcggtat cgatgccgtt       240
     gcgacgaccg ccacagtgtc aaacgctggc agcgcgacac cgcttgcttc ggccaatttc       300
     aatccggcca acggtcatcg ctatacggcg cttgccatcg taggcgccac ggcctcggcc       360
     accagcctgg cgatcatcga tgatccatat gacaaatcga ttctctcgga caaggcgcgt       420
     gtgcgtacct tcaacgccgc gtacaacgcc cccaatgtcg atgtctacgt gacggcgccg       480
     aacgcggata tttcggctgt gccaccgacc atgggcggcg ccgcatacgg tagcgcgtcg       540
     cctgccagca cacaggattc catctatgtg gacggtggca cgtacgagat acgcgtgacg       600
     acggccggca caaagagcgt catcttcgcc tcgcagccat tcagcctggc caacaatgcg       660
     gactggctga tcaccacgct gcccgcaggc ggcgcgggca cggtcacccc caacgccatc       720
     cgcgtgctcg tggcccaggc caacggcgca tcgcaaacgg cttccgaatt acccgcgcag       780
     taa                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page