(data stored in SCRATCH zone)

EMBL: CP001069.PE184

CP001069.PE184       Location/Qualifiers
FT   CDS_pept        complement(215004..215519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3955"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: rme:Rmet_3441
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3955"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29060"
FT                   /db_xref="GOA:B2UHK9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHK9"
FT                   /protein_id="ACD29060.1"
FT                   /translation="MSKRATAGKDNDTSRNAPSIPEPGQGKRGEEGYLGYLLRQASAAQ
FT                   RLRMERAMADVGVTLPQFLVLTMLRAYPGISNADLARLTMLTPQTVSVIVTNLERSGAI
FT                   TRRPHAVHGRIQHIDVTPEGSALLAACRKRSGGIEQDLLEGFTPEEEEVVRRWLVHVAK
FT                   LGSDKPAS"
     atgagcaagc gtgctaccgc cggcaaggac aacgacacct cccgcaacgc gccctccatc        60
     cccgagcccg ggcagggcaa acgcggtgaa gaaggctatc tcggctacct gctgcgccag       120
     gccagcgccg ctcagcggct gcgcatggag cgcgccatgg ccgacgtggg cgtcacgctg       180
     ccgcaattcc tggtgctcac gatgctccgc gcctacccgg gtatctcgaa tgccgacctc       240
     gcccggctga ccatgctgac gccccagacg gtaagcgtca tcgtcaccaa cctggagcgc       300
     agcggcgcca ttacgcgccg accccacgcg gtgcacggcc gcatccagca catcgacgtc       360
     accccggaag ggtccgccct gctcgccgcg tgccgaaaac gctcgggcgg catcgagcag       420
     gatctgctcg aggggttcac gcccgaagag gaagaggtcg tgcggcgctg gctcgtacac       480
     gtcgccaagc tcggtagcga caaacctgcc tcctga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page