(data stored in SCRATCH zone)

EMBL: CP001069.PE185

CP001069.PE185       Location/Qualifiers
FT   CDS_pept        215598..216095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3956"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   reu:Reut_A3275 alkylhydroperoxidase AhpD core"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3956"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29061"
FT                   /db_xref="GOA:B2UHL0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL0"
FT                   /protein_id="ACD29061.1"
FT                   /translation="MEDLSPRMDYSEFVDTAVGVAPALQALGKAVDASGLEKPLTELIK
FT                   LRASQINGCAFCVQFHLNLARKLRVAPAKLDLVAVWRDTPAVFTPRERAALAWTEALTT
FT                   LARAADHGVEDHEYDAVLEHFSRTEVAFLTAAVANIQAWNRIAVAMRFAPQVPAAVTAE
FT                   QA"
     atggaagatc tttcccctcg catggattac tcggaatttg tcgatactgc cgtcggcgtg        60
     gcgccggcgc tgcaggcgct cggtaaggcg gtggacgcct cggggctgga aaagccgctg       120
     accgaactca tcaagctgcg cgcctcgcaa atcaacggct gcgcgttctg cgtgcaattc       180
     cacctgaacc tggcgcgcaa gctgcgcgtg gcgccggcca agctcgatct ggtggcggtc       240
     tggcgcgaca cgccggcggt cttcacgccg cgcgagcgcg ccgcgctggc ctggacggaa       300
     gcgctgacca ccctggcccg cgcggccgac cacggggtgg aggatcacga atacgacgcc       360
     gtgctcgagc atttctccag gacggaagtc gccttcctca cagccgccgt cgccaacatc       420
     caggcgtgga accgtattgc cgtcgcaatg cgctttgcgc cgcaggtgcc ggctgccgtg       480
     accgcggagc aagcatga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page