(data stored in ACNUC7421 zone)

EMBL: CP001069.PE187

CP001069.PE187       Location/Qualifiers
FT   CDS_pept        216538..217164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3958"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: reu:Reut_A3273
FT                   (acyl-carrier protein) phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3958"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29063"
FT                   /db_xref="GOA:B2UHL2"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL2"
FT                   /protein_id="ACD29063.1"
FT                   /translation="MTTLLHVTVSPRDDRSHSRRGAKWVVAQLAEAVGGLRVIERDLAA
FT                   TPLPHPDAGFVEASLTPDADRTAAHRAALALSETLIGELGAADAVLISTPVHNYTVPSA
FT                   LKAWIDLVVRPERTFRRTPTGKVGMLTDRSVLVVSASGGHFDGAHAQTDFLMPYLRYVF
FT                   ATVGIHQVEGIRLQNTARGADSAMQAFESFRQELAARMLLMPLVA"
     atgacaacac tgctgcacgt gaccgtgagc ccgcgcgacg atcgctcgca cagccggcgt        60
     ggcgcaaagt gggtggtcgc acaattggca gaggccgttg gtggcctgcg cgtcatcgag       120
     cgcgatctgg cggccacgcc gttgccgcat cccgatgccg gttttgtcga ggccagcctc       180
     acgcccgatg ccgaccgcac cgcagcgcac cgtgcagcgc ttgcgctgtc ggaaacgctg       240
     atcggcgaac tgggagcagc ggatgccgtg ttgatttcca cgccggtgca caactacacg       300
     gtgccttcgg cgttgaaggc gtggatcgat ctggtggtgc ggcccgaacg cacgttccgc       360
     cgcacgccca cgggcaaggt gggcatgctg accgatcgct cggtgctggt ggtatccgct       420
     tcaggcggcc actttgacgg cgcccacgcg cagaccgatt tcctgatgcc atatctgcgt       480
     tatgtgtttg ccacggtggg catccatcag gtggaaggca tccgcttgca gaacactgcg       540
     cgcggtgctg attccgccat gcaggccttc gaaagtttcc ggcaggaact ggctgcgcgg       600
     atgttgctca tgccgctggt ggcctga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page