(data stored in ACNUC7421 zone)

EMBL: CP001069.PE192

CP001069.PE192       Location/Qualifiers
FT   CDS_pept        221233..221676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3963"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3963"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29068"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL7"
FT                   /protein_id="ACD29068.1"
FT                   /translation="MFRVYKAMAVAITAAVGASGALAAGSQDGVIYFTGAIVEAGFRVL
FT                   PALQATGTGEGLQARRSASGDQVVLDFRSTAVRAVPVDVSVEARAASSLNPLRVGDARS
FT                   KADVLAKYGGFKANLLTANNGTLTLSRAPGVEPALAVVTLSYQ"
     atgttcaggg tctacaaggc aatggccgtc gccatcacgg cggccgtcgg agcgagtggc        60
     gcgcttgcgg ccggcagcca ggacggcgtg atttatttca cgggcgccat cgtcgaggcg       120
     gggttccgtg tgctgccagc gctgcaggcg acgggcacgg gcgagggttt gcaggcgcgt       180
     cgctctgcgt caggcgatca ggtggtgctc gactttcgct cgacagcggt gcgggccgtg       240
     ccggtcgatg tgtcggtgga ggctcgcgcg gcatcgtcgc tcaaccccct gcgggtgggc       300
     gatgcacgca gcaaggcgga cgtcctggcc aaatacggcg gtttcaaggc caacctgctg       360
     acggcaaaca acggcacgct gaccttgtcg cgcgcgccgg gggtggaacc agcgctcgcg       420
     gtggtgacgc tgtcctacca gtaa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page