(data stored in ACNUC7421 zone)

EMBL: CP001069.PE193

CP001069.PE193       Location/Qualifiers
FT   CDS_pept        complement(221728..223341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3964"
FT                   /product="periplasmic glucan biosynthesis protein MdoG"
FT                   /note="PFAM: periplasmic glucan biosynthesis protein MdoG;
FT                   KEGG: rso:RS03704 glucan biosynthesis protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3964"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29069"
FT                   /db_xref="GOA:B2UHL8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHL8"
FT                   /protein_id="ACD29069.1"
FT                   /translation="MVTRRTLLASASVTATLAALGITPEALAADRVKLGDAAPFSFDAL
FT                   IERARTMAGKPYTPPATAPADILSKIDYEAHGKIKFDTAHALFADGPGQFPVTFFHLGT
FT                   FFRAPVRMHVVEKGAAREIVYDESYFDMPADSPARKLPRGSGFAGFRFQESRLGDQKKL
FT                   DWKKNDWVAFLGASYFRAIGELYQYGLSARGIALDVAQAGKPEEFPNFTHVWFDTPADN
FT                   RADSVTIYTLLDGPSITGAYRFVMHRTKGVVMDIDTAIFLRKDVDRFGIAPATSMYWFS
FT                   ETAKGTATDWRPEVHDSDGLALWTGNGERIWRPLNDPPRTMASAFGDNNPRGFGLLQRD
FT                   RDFNNYQDGVHYERRPSLWVEPLEGWGEGAVQLIEIPTDDEIHDNIVAMWVPKAPARAG
FT                   SQYRLRYRLHWLADEPYPTQLARCVATRMGNGGQPGQPRPRGVRKFMVEFKGGPLEKLP
FT                   FGTKPEAVLSTSRGTFSYVFTEAVPNGVPGHWRAQFDLTVDGKEPVDMRLFLRVDGKPL
FT                   SETWLYQYHPFQSPVGPVAS"
     atggtcacac gtcgaaccct tcttgcctcc gcctcggtta ccgccacgct ggcggcgctc        60
     ggcatcacgc ccgaagcact ggccgccgat cgcgtcaagc tgggcgatgc cgcgccgttt       120
     tctttcgatg cgctgatcga gcgcgcccgc acgatggccg gcaagcctta cacgccccct       180
     gcaacggcgc cggccgacat cctgtccaag atcgactacg aggcacacgg caagatcaaa       240
     ttcgacaccg cccacgcact ctttgcggac ggccccggcc agtttccggt gacgttcttc       300
     cacctcggca cgttcttccg cgccccggtg cgcatgcacg tggtggaaaa aggcgccgcc       360
     cgcgaaatcg tttacgacga atcgtacttc gacatgcccg ccgacagccc ggcgcgcaaa       420
     ctgccgcgcg gcagcggctt tgccggtttc cgcttccagg aaagccgcct gggtgaccag       480
     aagaaactcg actggaagaa gaacgattgg gtcgccttcc tgggcgcgtc gtacttccgc       540
     gccatcggcg agctgtatca gtacgggctt tccgcacggg gcattgcgct ggacgtggcg       600
     caggccggca agccggaaga gtttcccaat ttcacgcacg tgtggttcga cacgccggca       660
     gacaaccgcg ccgattccgt gacgatctac acgctgctcg acggcccgag catcacgggt       720
     gcatatcgct ttgtcatgca ccgcacgaag ggcgtggtga tggacatcga cacggccatc       780
     ttcctgcgca aggacgtcga ccgtttcggc atcgcgcccg ccacgtcgat gtactggttt       840
     tcggaaaccg ccaagggcac cgccactgac tggcgccccg aggtgcacga ctccgacggc       900
     ctcgccctct ggaccggcaa tggcgagcgc atctggcgcc cgctgaatga tccgccgcgc       960
     acgatggcgt ctgcctttgg cgacaacaac ccgcgcggct tcggcctgct gcagcgcgat      1020
     cgcgatttca acaactacca ggacggcgtc cactacgagc gccgcccgag cctgtgggtc      1080
     gagccgctgg aaggctgggg cgagggcgcc gtgcagctta tcgaaatccc gaccgacgac      1140
     gagatccacg acaacatcgt cgccatgtgg gtgccgaagg caccggcgcg tgcgggcagc      1200
     cagtaccgtc tacgctatcg cctgcactgg ctggccgatg aaccgtatcc gacacaactg      1260
     gcgcgctgcg tggccacgcg catgggcaac ggcgggcagc cgggccagcc gcggccgcgc      1320
     ggcgtgcgca aattcatggt cgagttcaag ggcggtccgc tggagaaact gcctttcggc      1380
     accaagccgg aggccgtgct gagcacctcg cgcggcacgt tctcgtatgt gtttaccgaa      1440
     gccgtgccga acggcgtgcc gggccactgg cgcgcccagt tcgacctgac ggtcgacggg      1500
     aaggaaccgg tcgacatgcg gctgtttttg cgtgtggatg gcaagccgct gtccgagacg      1560
     tggctgtatc aatatcaccc gttccaatcg ccggtggggc cagtggcgtc ctaa            1614
//

If you have problems or comments...

PBIL Back to PBIL home page