(data stored in SCRATCH zone)

EMBL: CP001069.PE195

CP001069.PE195       Location/Qualifiers
FT   CDS_pept        complement(224712..225191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3966"
FT                   /product="Domain of unknown function DUF1854"
FT                   /note="PFAM: Domain of unknown function DUF1854; KEGG:
FT                   rme:Rmet_0706 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3966"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29071"
FT                   /db_xref="InterPro:IPR015005"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM0"
FT                   /protein_id="ACD29071.1"
FT                   /translation="MTAMQTPDFALSRNGFGKLVMTLADGTVHEGVVPVRAFPISAAGE
FT                   GLSLMSTDGRELAWITQPDALPTPMRALIEAELGAREFMPEIRTIVGVSTYATPSTWTV
FT                   QTDRGQTDLVLRGEEDIRRLTGTTLLISDSHGIHYLIRDLLALDKHSRKILDRFL"
     atgactgcga tgcaaacgcc cgatttcgcc ctgagccgca acggcttcgg caaacttgtg        60
     atgaccctgg ccgacggcac cgtgcatgaa ggcgtggtgc ccgtgcgcgc gttcccgatc       120
     tccgccgcgg gcgagggctt gagcctgatg agcacggacg gccgcgagct ggcatggatc       180
     acgcaacccg acgcgctgcc cacgccaatg cgcgcgctga tcgaagccga actcggcgcg       240
     cgggaattca tgcccgagat ccgcacgatc gtcggcgtat cgacctacgc cacgcccagc       300
     acgtggacgg tgcagaccga ccgcggccag accgacctcg tgctgcgcgg cgaagaagat       360
     atccgccgcc tgaccggcac cacgctgctc atttccgaca gccacggtat ccactacctg       420
     atccgcgatc tgcttgcgct ggacaagcac agccgcaaga tcctcgaccg gttcctgtaa       480
//

If you have problems or comments...

PBIL Back to PBIL home page