(data stored in ACNUC7421 zone)

EMBL: CP001069.PE196

CP001069.PE196       Location/Qualifiers
FT   CDS_pept        complement(225205..227511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3967"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: rme:Rmet_0705
FT                   ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3967"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29072"
FT                   /db_xref="GOA:B2UHM1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM1"
FT                   /protein_id="ACD29072.1"
FT                   /translation="MTQSSPSSAPTVVRAQEPWRVVLGSSLAPEETVLAGLQLDLDARL
FT                   HFTQGWLVVTNRRLIGQAVGEKDLQSWDIAPGMTLAHSDHAGVGTLELSDGQRRLASWR
FT                   YTLGHNTDALRLADAFDAQRNALTTGAKAAQPDADICPTCKAPLPAGEDNCPQCSRELE
FT                   QPPSTWALLRLWRFAQPYRWELLAGFALLLIGTAATLVPPYLTMPLMDKVLIPYQNGQP
FT                   VDYRLVTLYLSGLFGAALVAWVLGWARTYLLARVSERISADLRTTTYEHLLKLSLEYFG
FT                   GKRTGDLMARIGSESDRISVFLSLHLLDFATDVLMIAMTAVILVSIDPWLALVTLVPLP
FT                   FIAWMIHLVRDRLRHGFEKIDRIWSEITNVLADTIPGIRVVKAFAQEKREVTRFAEANK
FT                   HNLAINDRVNAVWSLFTPTVTLLTEVGLLVVWIFGIWRVSHDAITVGVLVAFLTYISRF
FT                   YTRLDSMSRIVSVTQKAAAGAKRIFDILDHVSSVPEPARPVHLEKVKGAIELRDLGFRY
FT                   GNRAVIRGLNLSIQPGEMIGLVGHSGSGKSTLVNLICRFYDVSEGAIRLDGTDIRSLPV
FT                   SEFRRNIGLVLQEPFLFFGTIADNIAYGKPDATREEIIAAARAAHAHEFILRLPHGYDS
FT                   LVGERGQALSGGERQRISIARALLINPRILIMDEATSSVDTTTEKEIQKALDNLVQGRT
FT                   TIAIAHRLSTLRKADRLVVMDRGQIVEVGNHDELLAREGAYYKLYQAQARNVDAETDLT
FT                   SDGERVDAAAPAYAQ"
     atgacccagt cctccccatc gtccgccccc accgtcgtcc gcgctcagga accctggcgt        60
     gtcgtgctcg gctcaagcct tgctccagaa gaaaccgtcc tggccgggct gcagctggat       120
     ttggacgcga gattgcattt tacccaaggg tggctggttg ttacgaaccg tcgcctgatc       180
     ggccaagccg tgggtgaaaa ggatttgcaa agctgggaca tcgcccccgg catgacgctg       240
     gcccacagcg accacgccgg cgtcggcacg ctggagttgt ccgacggcca gcgccggctg       300
     gcaagctggc gctacacgct gggccacaat accgacgcgc tgcggctggc cgatgctttc       360
     gacgcccagc gcaacgccct gaccaccggc gccaaggccg cgcagcccga cgcggacatc       420
     tgcccgacct gcaaagcgcc cctcccggcc ggtgaagaca actgcccgca atgcagccgt       480
     gaactggagc agccgccctc gacctgggcg ctgctgcgcc tgtggcgctt cgcccagccg       540
     tatcggtggg aattgctggc cggtttcgcc ctgctgctga tcggcacggc cgccaccctg       600
     gtgccgccgt acctgacgat gcccttgatg gacaaggtgc tgatccccta ccagaacggg       660
     cagccggtcg attaccgcct ggtgacgctc tatctgtccg gcctgtttgg cgccgcgctg       720
     gtggcctggg tgctgggctg ggcgcgcacg tatctgctgg cgcgcgtgtc cgagcgcatc       780
     agcgccgacc tgcgaacgac cacctacgag cacctgctca agctgtcgct cgaatatttc       840
     ggtggcaagc gcaccggcga cctcatggcg cgcatcggtt cggaaagcga ccgcatcagc       900
     gtgttcctgt cgttgcacct gctcgatttc gccacggatg tgctgatgat cgcgatgacg       960
     gccgtcatcc tggtttcgat cgacccatgg ctggcgctcg tgacactcgt gccgctgcca      1020
     ttcatcgcgt ggatgatcca cctggtgcgc gaccgcctgc gccacggctt cgagaagatc      1080
     gaccggatct ggtcggaaat caccaacgtg ctggccgata cgatcccggg catccgcgtg      1140
     gtcaaggcct ttgcgcagga aaagcgcgag gtgacgcgct ttgccgaggc caacaagcac      1200
     aacctggcga tcaacgatcg cgtcaatgcg gtgtggtcgc tgtttacccc gaccgtcacg      1260
     ctgctgaccg aagtcgggct gctggtggtg tggatcttcg gcatctggcg ggtgagccac      1320
     gacgccatta ccgtcggtgt gctggtggcg ttcctgacct atatcagccg cttctacacg      1380
     cgcctggatt ccatgagccg catcgtgtcc gtcacgcaga aggcggcggc cggcgccaag      1440
     cggatcttcg atattctcga ccacgtgtcg agcgtgcccg agccggccag gcccgtgcat      1500
     ctcgagaagg tgaagggcgc gatcgaactg cgcgacctgg gcttccgtta tggcaaccgc      1560
     gcggtgatcc gcggcctgaa cctgtcgatc cagccgggcg agatgatcgg gctggtgggg      1620
     cacagcggct cgggcaagag cacgctcgtg aacctgatct gccgtttcta cgatgtgtcc      1680
     gaaggcgcga tccgcctgga tggcaccgat atccgctcgc tgcccgtgtc ggaattccga      1740
     cgcaacatcg gcctggtgct gcaggagccg ttcctgttct tcggcacgat cgccgacaac      1800
     attgcctacg gcaaacccga cgccacgcgc gaagagatca ttgccgccgc gcgtgccgcc      1860
     cacgcccacg agttcatcct gcgcctgccg cacggctacg actcgctggt gggtgaacgc      1920
     ggccaggccc tgtcgggcgg cgaacgccag cgtatttcga ttgcgcgggc cctgctcatc      1980
     aacccgcgca tcctgatcat ggacgaggcc acgtcttccg tggacacgac caccgagaag      2040
     gaaatccaga aggcgctcga caacctcgtg cagggccgca cgaccattgc catcgcgcac      2100
     cgtttgtcga cgctgcgcaa ggcggatcgc ctggtcgtca tggatcgcgg ccagatcgtc      2160
     gaagtcggca atcacgatga gctgctcgcg cgcgaagggg cgtactacaa gctctatcag      2220
     gcgcaggccc gcaatgtcga tgccgaaacc gatctgacca gcgacggcga gcgcgtggac      2280
     gccgcggcgc cggcttacgc gcagtga                                          2307
//

If you have problems or comments...

PBIL Back to PBIL home page