(data stored in SCRATCH zone)

EMBL: CP001069.PE198

CP001069.PE198       Location/Qualifiers
FT   CDS_pept        230515..233082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3969"
FT                   /product="cyanophycin synthetase"
FT                   /note="TIGRFAM: cyanophycin synthetase; PFAM:
FT                   phosphoribosylglycinamide synthetase; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp;
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; RimK domain protein
FT                   ATP-grasp; KEGG: rme:Rmet_0703 cyanophycin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3969"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29074"
FT                   /db_xref="GOA:B2UHM3"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011810"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM3"
FT                   /protein_id="ACD29074.1"
FT                   /translation="MEVSRIRALRGPNLWCRHTAIEAIVACSDQSQLLAELPGFEDRLR
FT                   ARFPAIGPMRPDDEADAPSIAHALEAAALGLQAAAGCPVTFSHTEPTLEPGTYQVVVEY
FT                   TEEEVGRLAFELAGQLCLAARDDQPFDLDDALHRLRELDEDVRLGPSTGSIVDAAVVRG
FT                   IPYRRLTQGSMVQFGWGSKQRRIQAAETDMTSAVAESIAQDKDLTKALLHAAGVPVPLG
FT                   RSVRSAEEAWEAAQEIHGPVVVKPRDGNQGKGVAVRIRTREEVMTAYEAAADISSDVIV
FT                   ERYIPGHDFRLLVVGKHLVAAARRDPPQVIGDGKHTVRELVDEVNRDPRRGEGHATSLT
FT                   KIRFDDIALATLAKQGLSADAVPPKGTRVVLRNNANLSTGGTATDVTDDVHPAIAARAV
FT                   AAAQMVGLDICGVDAVCETMLKPFEDQAGGIVEVNAAPGLRMHLQPSYGKGRAVGEAIV
FT                   STMFADGDDGRIPVVAVSGTNGKTTTVRLITHLLASSGLRMGMTGTDGVYIQGQRIDTG
FT                   DCSGPRSARNVLLHPDVDAAVFETARGGLLREGLAFDRCDVAVVTNVGEGDHLGLNYIS
FT                   TVEDLAVLKSVIVQNVAPRGMAVLNAADPMVARMAEGCPGSVTFFAHDPGLPTLALHRA
FT                   QGKRVVFVDGPEIVAAEGANETRIALADIPLTRNGTIGFQVENAMSSIAAAWALGIDWT
FT                   VIRRGLATFVNDAATAPGRFNLFDYKGATLIADYGHNPDAIQALCNAVATMPAQRRMVV
FT                   ISGAGDRRDEDIRKQTQILGGVFDDVVLYEDQCQRGRADGEVLALLREGLQGASRTSRV
FT                   DEIRGEFLAIDTALGRLQPGDLCLILIDQVEEALEHIARRVAE"
     atggaagtct ctcgtatccg ggccttgcgc ggcccaaatc tctggtgccg ccatacggcc        60
     atcgaggcca tcgtggcctg ctcggaccaa tcccaactgc tggccgagct gccgggcttt       120
     gaagaccgcc tgcgcgcgcg ctttccggcg attggcccga tgcgccccga tgacgaagcc       180
     gatgcgccat cgattgcgca cgcgctggaa gccgccgcgc tgggcctgca agctgccgcc       240
     ggttgcccgg tgacgttcag ccacaccgag cccacgctcg aaccgggcac gtatcaggtc       300
     gtcgtcgaat acaccgaaga agaagtgggc cgactggcat tcgagctggc cggccaactt       360
     tgcctggccg cccgcgacga ccagccgttt gatctggacg atgcactgca ccgcctgcgc       420
     gagctggacg aagacgtacg cctggggccg agcaccggct ccatcgtcga cgccgccgtg       480
     gtgcgcggca ttccgtatcg ccgcctcacg cagggctcga tggtgcagtt tggctggggc       540
     agcaaacagc gccgcattca ggccgccgaa accgacatga ccagcgccgt ggccgaatcg       600
     atcgcgcagg acaaggacct cacgaaggcc ctgctgcatg cggccggtgt gccagtgccg       660
     ctgggccgtt cggtgcgcag cgccgaggaa gcctgggaag ccgcgcagga aatccacggc       720
     ccggtcgtgg tcaagccccg cgacggcaac cagggcaagg gcgtggccgt acgcatccgc       780
     acgcgcgaag aagtgatgac ggcgtacgaa gcggcggccg acatttcttc ggacgtgatc       840
     gtcgagcgct acatccccgg ccatgacttc cgtctgctcg tggtgggcaa gcacctggtg       900
     gcagctgcgc gccgcgaccc gccgcaagtc atcggtgacg gcaagcacac cgtgcgcgag       960
     ctggtcgacg aagtgaaccg cgacccgcgc cgcggcgaag gacatgccac gtcgctcacg      1020
     aaaatccgct tcgacgacat tgcactggcc acgctcgcca agcagggcct gagcgccgac      1080
     gccgtgccgc ccaagggcac gcgcgtggtg ttgcgcaata acgcgaacct ttccacgggc      1140
     ggcaccgcca ccgacgtgac cgacgacgtg cacccggcta tcgcggcgcg tgccgtcgcg      1200
     gccgcgcaga tggtcggcct cgacatctgc ggggtagacg ccgtgtgcga aaccatgctc      1260
     aagccgttcg aggaccaggc cggcggcatc gtggaagtca acgccgcacc gggtttgcgc      1320
     atgcacctgc agccgtcgta cggcaagggc cgtgccgtgg gcgaggcgat tgtctcgacg      1380
     atgtttgcgg atggcgacga cggccgcatc cccgtggtgg cggtgtccgg caccaacggc      1440
     aagacgacga ccgtgcgcct gattacccat ctgctggcgt ccagtggtct gcgcatgggc      1500
     atgaccggca ccgatggcgt gtacatccag ggccagcgca tcgacaccgg cgactgcagc      1560
     ggcccgcgca gcgcgcgcaa cgtgctgctg catccggatg tcgatgccgc cgtcttcgaa      1620
     accgcgcgcg gcggcctgct gcgcgaaggt cttgcgttcg accgctgcga tgtggccgtg      1680
     gtgacgaacg tgggcgaagg cgaccacctg ggcctgaact acatcagcac ggtggaagac      1740
     ctggccgtgc tcaagagcgt gatcgtgcag aacgtggcgc cgcgcggcat ggcggtgctc      1800
     aacgccgccg acccgatggt cgcgcgcatg gcggagggct gccctggttc ggtcacgttc      1860
     ttcgcgcacg atccgggcct gccgaccctg gcgctgcacc gcgcgcaggg caagcgcgtg      1920
     gtgtttgtcg atggccccga gatcgtagcc gccgaaggtg ccaacgaaac gcgcatcgca      1980
     ctggccgaca ttccgctcac gcgcaacggc acgatcggat tccaggtgga aaacgcgatg      2040
     tcgtcgattg cggcggcatg ggcgcttggc atcgactgga cggtgatccg ccgcgggctg      2100
     gcgacgtttg tgaacgacgc cgcaaccgcg ccggggcgct tcaacctgtt cgactacaag      2160
     ggcgccacgc tcatcgccga ctacggccat aacccggatg ccatccaggc actgtgtaac      2220
     gcggtagcca ccatgccggc gcagcgtcgc atggtggtga tcagcggggc cggcgaccgc      2280
     cgcgacgaag atatccgcaa gcagacgcag attcttggcg gcgtgtttga cgatgtcgtg      2340
     ctgtatgaag accaatgcca gcgcgggcgc gccgatggtg aagtgcttgc gctgctgcgt      2400
     gaagggttgc agggtgcgtc acgcacgagc cgtgttgatg aaatccgtgg tgaatttctg      2460
     gctatcgaca ccgcgctggg gcggttgcag ccgggggacc tctgcctgat tttgattgat      2520
     caggtggagg aggcattgga gcatattgct cggcgggttg ctgagtag                   2568
//

If you have problems or comments...

PBIL Back to PBIL home page