(data stored in SCRATCH zone)

EMBL: CP001069.PE199

CP001069.PE199       Location/Qualifiers
FT   CDS_pept        233728..234309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3970"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: cvi:CV_3073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3970"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29075"
FT                   /db_xref="GOA:B2UHM4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM4"
FT                   /protein_id="ACD29075.1"
FT                   /translation="MPNPITPAPVELAKCYRLLNHGPTTLVTSAHNGVRNVMAAAWAMP
FT                   LDFDPPKVLVVVDSRTLTRELIEGSGVFALNIPTRAIAETTLTVGTLSGRDVDKFDALG
FT                   LVTMPARTIDVPLVAGCAGWLECRVIPEPHNEKRYDLFIAEVTAAWANPALFSNGRWHF
FT                   TDAGSKTLHYLAGGAFFETGEAFTVEVKQL"
     atgcccaatc ccatcacgcc agccccggta gaactggcga agtgctaccg cctcctgaac        60
     cacggcccga ccacgctggt cacctccgcc cacaacggcg tgcgcaacgt catggctgcc       120
     gcctgggcga tgccgctcga ctttgaccca cccaaggtgc tggtcgtggt cgacagccgc       180
     acactcacac gtgagttgat cgaaggctcg ggcgtgtttg cactcaacat tcccacccgc       240
     gcgattgccg agaccacgct gacggtcggc acactctcgg gccgcgatgt cgacaagttc       300
     gatgccctgg gcctcgtcac catgcccgcc cgtacgatcg acgtgccgct ggtggcaggt       360
     tgtgcagggt ggctcgaatg ccgcgtcatt ccggagccgc acaacgagaa gcgctacgac       420
     ctcttcatcg cagaagtgac cgccgcctgg gccaatcctg cgctgttcag caacggtcgc       480
     tggcacttta cggatgctgg cagcaagacc ctgcactacc tcgcgggcgg tgcattcttt       540
     gagaccggcg aagcgttcac cgtcgaggtg aaacagctat ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page