(data stored in ACNUC7421 zone)

EMBL: CP001069.PE2

CP001069.PE2         Location/Qualifiers
FT   CDS_pept        1899..2207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3762"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS02222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3762"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28878"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH27"
FT                   /protein_id="ACD28878.1"
FT                   /translation="MKLPYCGGRRESCFAIRKDVKKEGVQIVRSRTPVDPAVQRILETT
FT                   RKAWQLDAESVRAARQQRAANRRKRIKALPQDSLQALAALALQAEIWAVRKTVVTVG"
     atgaagctcc cgtattgtgg gggccgtcgc gaaagttgct ttgcgatccg gaaagacgtg        60
     aagaaggaag gagtccaaat cgtgcgtagt cgaacccctg tcgatcccgc cgtgcaacgc       120
     attctggaaa ccacgcgcaa ggcgtggcaa ctggatgccg aaagcgtgcg tgcggcgcgt       180
     caacagcgtg ccgccaatcg ccgcaagcgg atcaaggccc tgccgcagga cagcctgcag       240
     gcgctcgctg cactcgccct gcaggcggaa atctgggcgg tgcgcaagac cgtggtgacg       300
     gtcggctag                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page