(data stored in SCRATCH zone)

EMBL: CP001069.PE20

CP001069.PE20        Location/Qualifiers
FT   CDS_pept        complement(20561..21865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3780"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   rso:RS02237 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3780"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28896"
FT                   /db_xref="GOA:B2UH45"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH45"
FT                   /protein_id="ACD28896.1"
FT                   /translation="MTWLTRFFKLKEHQTDVRTEVLAGLTTFLTMAYIVFVNPNILADA
FT                   GMPHDAVFVATCIAAATGTIIMGMYANYPIAMAPGMGLNAYFAYAVVKGMGFTWQAALG
FT                   AVFISGCLFLLVSVFRIREMIVNGIPHSIRVAITAGIGLFLGIVSLRGAGLVVGNPATL
FT                   VSLGDVHQPSVILAVIGFFLIVALDHLRVKGAILIGILAVTAASFFFAGNTFHGVVSMP
FT                   PSLTPTLLQLDIMGALSVGILNVVLVFFLVELFDATGTLMGVANRAGLLKQGKMDRLNK
FT                   ALLADSTAIMAGSLLGTSSTTAYIESASGVQAGGRTGLTALTVAVLFLLCLFFSPLAGV
FT                   VPAYATAPALLYVSCLMLRELVDLNWEDTTEAVPAVLTALMMPFTYSIANGVAFGFITY
FT                   SGLKLFTGRAREVPIIVWIISAVFLFRFFYLSGGH"
     atgacctggc ttacgcgctt tttcaagctc aaggaacatc agaccgacgt gcgcaccgag        60
     gtgctcgccg gcctgacgac gttcctcaca atggcgtaca tcgtcttcgt gaacccgaac       120
     atcctggccg acgcgggcat gccccacgac gccgtgttcg tggccacctg catcgctgcc       180
     gccaccggca cgatcatcat ggggatgtac gccaactatc cgatcgccat ggcgcccggc       240
     atggggctga acgcctattt tgcgtatgcg gtggtcaaag gcatgggctt tacgtggcag       300
     gcggcgctcg gcgcggtgtt catttcgggc tgcctgttcc tgctggtgag cgtattccgc       360
     atccgcgaaa tgatcgtcaa cgggattccg cattcgatcc gcgtggcgat cacggcggga       420
     atcgggctgt tcctgggcat cgtgtcgctg cggggtgccg gcctggtcgt cggcaatccg       480
     gcgacgctgg tttccctggg cgatgtgcat cagccatcgg tcattctcgc cgtgatcggc       540
     ttcttcctga tcgtggcact ggaccatctg cgcgtgaagg gcgccatcct gatcggcatt       600
     ctggccgtga cggcagcgag cttcttcttt gccggcaaca ctttccacgg ggtggtgtcg       660
     atgccgccgt cgctgacgcc gacgctgctc cagctcgaca tcatgggcgc gctctcggtt       720
     ggcatcctca acgtggtgct ggtgttcttc ctggtggagc tgtttgacgc gaccggcacg       780
     ctgatgggcg tggccaaccg tgccggtctg ctcaagcagg gcaagatgga ccgtctgaac       840
     aaggcgttgc tggcggacag cacggccatc atggccgggt cgctgctggg cacgtcgtcc       900
     accacggcct acatcgaaag cgcgtccggg gtgcaagccg gaggccgcac gggcctgacc       960
     gcactgacgg ttgcggtgct gtttctgctg tgcctgttct tctcgccgct ggccggggtg      1020
     gtaccggcgt acgccaccgc gcccgcgctg ctgtacgtgt cctgcctgat gctgcgcgaa      1080
     ctggtggacc tgaactggga ggacaccacc gaagccgtgc cggccgtgct gaccgcgctg      1140
     atgatgccgt tcacctattc gattgccaat ggtgtcgcgt ttggcttcat cacctactcg      1200
     ggcctcaagc tatttaccgg ccgtgcccgc gaggtgccga tcatcgtgtg gatcatctcg      1260
     gccgtgtttc tgttccgatt cttctatctg tcgggcggac actga                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page