(data stored in ACNUC7421 zone)

EMBL: CP001069.PE202

CP001069.PE202       Location/Qualifiers
FT   CDS_pept        235997..237130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3973"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: rso:RS05570
FT                   probable acyl-CoA dehydrogenase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3973"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29078"
FT                   /db_xref="GOA:B2UHM7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM7"
FT                   /protein_id="ACD29078.1"
FT                   /translation="MDDFYTEEQRMIHDAARAFATERLAPNAAQWDRDGALPDEVVREM
FT                   GELGLLGMIVPAEWGGSYTDYVAYALALEEVAAGCAASATMMSVHNSVGCGPILKFGTE
FT                   AQKARYLPDLATGRAIGAFCLTEPHAGSEANNLRTRAVLRDGKWVLTGNKQFVTNGARA
FT                   DIAIVFAVTDPEAGKRGISAFIVPTDTPGFHVGRPEHKLGIRASDTCPITLEDCAVPEE
FT                   NLLGERGEGLKIALSNLEGGRIGIAAQAVGIARAAFDAARNYANERIQFGKALREHQTI
FT                   ANMLADMATRLNAARLLVHHAARLRSADKPCLSEASQAKLYASELAEEICSNAIQIHGG
FT                   YGYLADYAVERHYRDARITQIYEGTSEVQRMVIARHV"
     atggacgact tctataccga agagcagcgg atgatccacg acgctgcgcg cgcctttgcc        60
     accgaacgcc tggcgcccaa cgccgcgcag tgggaccgtg acggcgcctt acccgacgag       120
     gtggtgcgcg agatgggcga gctgggcctg ctgggcatga tcgtgccggc ggagtggggc       180
     ggttcgtaca ccgactacgt ggcctatgcg cttgcgctgg aagaggtggc tgccgggtgc       240
     gctgccagcg cgacgatgat gagcgtgcac aactcggtgg gctgcggccc catcctcaag       300
     ttcggcaccg aggcgcagaa ggcgcgttac ctgccggacc tggccacggg ccgcgcgatt       360
     ggcgcgttct gcctgaccga gccgcacgcc ggctccgaag ccaacaacct gcgcacccgt       420
     gcggtactgc gcgacggcaa gtgggtgctc accggcaaca agcagttcgt caccaacggc       480
     gcacgcgcgg acatcgccat cgtctttgcc gtgacggacc ctgaggcggg caagcgcggc       540
     atctcggcct tcatcgtgcc gacggacacg ccgggctttc acgtcgggcg tcccgaacac       600
     aagctcggca ttcgcgcatc ggacacctgc ccgatcaccc tggaagactg cgccgtgccc       660
     gaagagaacc tgctgggtga gcgtggcgag ggcctgaaga tcgcattgtc gaacctggaa       720
     ggcggacgca tcggcattgc tgcgcaagcc gtgggcattg cgcgcgccgc gttcgatgcg       780
     gcgcgcaact acgcgaatga gcgcattcag ttcggcaagg cgctgcgcga gcaccagacc       840
     atcgccaaca tgctggccga catggccacg cgcctgaatg cggcgcgcct gctcgttcac       900
     cacgcagcgc gcctgcgcag tgcagacaag ccgtgcctgt cggaggcctc gcaggccaag       960
     ctctacgcgt cggaactggc ggaagagatc tgctccaacg ccatccagat tcacggcggc      1020
     tatggctact tggccgacta cgccgtcgag cgccactacc gcgatgcacg catcacccag      1080
     atctacgaag gcaccagcga agtccagcgg atggtgatcg cgcggcacgt gtag            1134
//

If you have problems or comments...

PBIL Back to PBIL home page