(data stored in SCRATCH zone)

EMBL: CP001069.PE204

CP001069.PE204       Location/Qualifiers
FT   CDS_pept        238959..240506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3975"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase_; KEGG: rso:RSp0650 probable
FT                   methylmalonate-semialdehyde dehydrogenase oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3975"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29080"
FT                   /db_xref="GOA:B2UHM9"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHM9"
FT                   /protein_id="ACD29080.1"
FT                   /translation="MSAVASLASAKPAAQQDTPPTVKLLIGGEFVESQSKEWRDIVNPA
FT                   TQEVLARVPFATAGEVDAAIRSAHAAFATWKNTPVGARMRIMLKFQALIREHSPRIART
FT                   LTAEQGKTLPDAEGDIFRGLEVVEHACSVGSLQQGEFLENVAGAVDTYTLRQPIGVCAG
FT                   ITPFNFPAMIPLWMFPMAIVCGNTFVLKPSEQDPLSTMQLVELALEAGVPPGVLNVVHG
FT                   GKDVVDALCTHEHVKAISFVGSTAVGTHVYRLGSEHGKRVQSMMGAKNHAVVLPDANRE
FT                   QAINALVGAAFGAAGQRCMATSVVVLVGAAQQWVPDLIAKAKTLKVNAGVEPGTDVGPV
FT                   VSRAAKQRILGLIESGVQQGATLALDGRNVRVAGYEDGNFIGPTIFTDVKTDMDIYTNE
FT                   IFGPVLLVLTVPTLDDAIALVNANRFGNGVGLFTQSGASARKFQSEIDVGQVGINIPIP
FT                   VPVPYFSFTGSRGSKLGDLGPYGKQVVQFYTQTKTVTARWFDDAVDTGGVNTTISLR"
     atgagcgccg ttgcctctct cgcttccgcc aagcctgccg cacagcagga caccccgccc        60
     accgtcaagc tgctgatcgg cggcgagttt gtcgaatcgc agtcgaagga atggcgcgac       120
     atcgtgaacc ccgccacgca ggaagtgctg gcgcgcgtgc cgtttgccac ggccggcgaa       180
     gtggatgcag ccatccgctc cgcacatgct gcgtttgcca cgtggaagaa cacgccagtc       240
     ggtgcgcgca tgcgcatcat gctgaagttc caggcgctga ttcgcgagca ctcgccgcgc       300
     attgcccgca cgctgacggc cgagcagggc aagacgctgc ccgatgccga aggcgatatc       360
     ttccgcgggc tggaagtggt ggagcacgcg tgctcggtgg gctcactgca gcagggcgag       420
     tttctggaga acgtggccgg cgcggtcgac acctacacgc tgcgccagcc gattggcgtg       480
     tgcgccggca tcacgccgtt caacttcccg gccatgattc cgctgtggat gtttccgatg       540
     gcgatcgtgt gcggcaacac gttcgtgctc aagccgtcgg agcaggatcc gctgtcgacc       600
     atgcaactgg tggaactggc ccttgaagca ggtgtgccgc ccggcgtatt gaacgtcgtg       660
     catggcggca aggacgtggt cgatgcactg tgcacgcacg aacacgtgaa ggcgatttcg       720
     tttgtgggct cgaccgcagt gggcacgcat gtttaccgcc tgggcagcga gcacggcaag       780
     cgcgtgcaat cgatgatggg cgccaagaac cacgccgtgg tgctgcccga cgcgaaccgc       840
     gagcaggcca tcaatgcgct ggtgggtgcg gccttcggcg cggcggggca acgctgcatg       900
     gcgacctccg tcgtcgtgct ggtgggcgct gcgcagcagt gggtgccgga cctgatcgcc       960
     aaggcaaaaa cgctcaaggt gaatgccggt gtcgagccgg gtaccgatgt cggccccgtc      1020
     gtctcgcgtg ccgccaagca acgcattctc ggcctgatcg aatcgggcgt gcagcagggc      1080
     gccacgctgg cgctcgacgg ccgcaatgtg cgcgtggccg gctacgaaga cggcaacttc      1140
     atcggcccga cgatcttcac cgacgtgaag accgacatgg acatctacac caacgaaatc      1200
     ttcgggcccg tgctgctggt gctgactgtg cctacgctgg acgacgccat tgcgctggtc      1260
     aacgctaacc ggttcggcaa cggtgtgggc ctgttcacgc agagcggcgc atcagcacgc      1320
     aagttccaga gcgagatcga cgtcgggcag gtcggtatca acattccgat tccggtgccg      1380
     gtgccgtact tcagctttac cggctcgcgc ggctccaagc tcggcgatct gggcccgtat      1440
     ggcaagcagg tcgtgcagtt ctatacgcaa acgaaaacgg taacggcgcg ctggtttgac      1500
     gacgcggtcg acaccggcgg cgtcaacacc accatcagcc tgcgctga                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page