(data stored in ACNUC7421 zone)

EMBL: CP001069.PE21

CP001069.PE21        Location/Qualifiers
FT   CDS_pept        23271..24344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3781"
FT                   /product="plasmid encoded RepA protein"
FT                   /note="PFAM: plasmid encoded RepA protein; KEGG:
FT                   rso:RSp0001 probable RepA replicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3781"
FT                   /db_xref="EnsemblGenomes-Tr:ACD28897"
FT                   /db_xref="InterPro:IPR006881"
FT                   /db_xref="UniProtKB/TrEMBL:B2UH46"
FT                   /protein_id="ACD28897.1"
FT                   /translation="MVTKRLTPNGKPEDAAPGRIIVPSGGQVIAAPEKFQRLFDEAQAM
FT                   EREDAWQSGEVGFLSRASVQVTLPYRAPKGSPPVWTRSSGNISLMIQPGYFTQQRSERA
FT                   SNGRQRIVSETVSFGYPYGSYPRLMLAWIGKEIMAKKKRGEFQGTVEDRRISLGNSLSE
FT                   FMYNLGIPMATGGKRGTMTLVRQQMIRLFSATIAIVQNKSAPNQNQNQEPLSIDRIGYL
FT                   LADQLSTWWDPMQPGQGSMFESFVVLSEPFFNELVNRPVPVDMRALKALKQSPFALDVY
FT                   SWLTYRFFTIQKRTEIPWEALQMQFGTETESERKFRALFRKALKDVLVVYPDAKVDADS
FT                   SKALILQPSRTSVRKLA"
     atggtcacca aacgcctgac acccaacggg aagccggaag acgccgcacc cggccgcatc        60
     atcgtccctt cgggaggaca ggtcattgct gcgccggaaa agtttcagcg gctcttcgat       120
     gaagcccagg ccatggagcg tgaagacgcc tggcaaagcg gcgaagtggg ctttctgagt       180
     cgcgcgagcg tgcaggtcac gttgccctac cgggcgccca agggctcgcc gccggtatgg       240
     acccggtcga gcggcaacat ctccctcatg atccagccgg gctacttcac gcagcagcgc       300
     tcggaacggg ccagcaacgg ccggcagcgg atcgtctccg agaccgtctc gttcggctat       360
     ccctacggct cgtatccccg gctgatgctg gcatggatcg gcaaggaaat catggccaag       420
     aagaagcgag gcgaattcca gggtaccgtg gaggaccggc gcatctcgct cggcaactcg       480
     ctttccgagt tcatgtataa cctgggcatc ccgatggcga ccgggggcaa gcgggggacc       540
     atgacgctgg tacgccagca gatgatccgg ttgttctcgg cgacgattgc catcgtgcag       600
     aacaagtccg cccccaacca gaaccagaat caggagccgc tatccatcga ccggatcggt       660
     tatctcctgg cagatcagct ctcgacctgg tgggacccga tgcaacccgg acaagggtcg       720
     atgttcgaga gcttcgtggt gctgtcggag ccgttcttca acgagctcgt caatcggccc       780
     gtgcctgtcg acatgcgtgc gctgaaagcg ctcaaacaat ccccgttcgc gctggacgtc       840
     tattcctggc tcacctatcg cttcttcacc atccagaagc gtacggagat accgtgggag       900
     gcgctgcaaa tgcagttcgg taccgagacg gagagcgagc gcaaattccg ggcgctgttt       960
     cgcaaggcgt tgaaggacgt gctggtcgtc tatccggacg ccaaggtcga tgcagattcg      1020
     tccaaagccc tgatcctgca gccttcacgc accagtgtgc gaaagttggc ttga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page