(data stored in ACNUC7421 zone)

EMBL: CP001069.PE210

CP001069.PE210       Location/Qualifiers
FT   CDS_pept        247489..248769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3981"
FT                   /product="Chloride channel core"
FT                   /note="PFAM: Chloride channel core; KEGG: rso:RSc1803
FT                   probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3981"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29086"
FT                   /db_xref="GOA:B2UHN5"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHN5"
FT                   /protein_id="ACD29086.1"
FT                   /translation="MKKMATRSEPLLMFGYLLRWLSLGSLVGMLAGLGSAVLLMALDWA
FT                   TNTRTAHPWLLWFLPVAGLAVGLLYHYTGRSVEGGNNLLIDEIHDPKRVVPKRMAPLIL
FT                   LSTVVTHIFGGSAGREGTAVQMGGSFADYLTRLFSLAPADRRILLMAGISAGFASVFGT
FT                   PLAGAVFGLEVLAIGRLRYDAILPCFIAAIVGDLVPPLLGVHHTPYAIPFVPHLTPVAI
FT                   GLVVVAGIVFGLAGMTFAALTHRLSRLLKRHIAFGPLRPVLGGSVVVAAALALGTDKYL
FT                   GLGIPVIVDTFHNPLPAYDFAGKAAFTIVTLASGFKGGEVTPLFYIGATLGNALGYVLP
FT                   LPFPLLAGLGFVAVFAGAANTPIASTLMAMELFGPEVGTFAGIACVVSYLFSGHTGIYH
FT                   AQRIGHAKRPTEAAPAGQVPAESAERP"
     atgaagaaaa tggctacacg ctccgagccg ctgctcatgt tcgggtatct gctgcgctgg        60
     ctttcgctcg gttcgctcgt cggcatgctc gccgggcttg gctctgcggt gttgctgatg       120
     gcgctcgatt gggcaaccaa cacgcgcacc gcacaccctt ggctgctgtg gttcctgccc       180
     gtggcggggc tggccgtggg cttgctctac cactacacgg ggcgctcggt ggaaggcggc       240
     aacaatctgc tcatcgacga gatccacgac cccaagcgtg tcgtccccaa gcgcatggcg       300
     ccgctcatcc tgctgagcac cgttgtcacc cacatctttg gcgggtcagc cgggcgtgag       360
     ggcacggccg tgcagatggg cggcagcttt gctgattacc tgacgcggct gttctcattg       420
     gccccggcgg accggcgcat cttgctgatg gcgggcatca gcgccggttt cgcgtcggtg       480
     ttcggcacgc cgctggccgg tgccgtattt ggactggaag tgcttgcgat cggccgtttg       540
     cgctatgacg cgatcctgcc gtgcttcatc gcggccatcg tgggcgacct ggtgccaccg       600
     ctgctgggcg tgcaccacac gccgtatgcg attccgtttg tgccgcatct cacgcccgtc       660
     gcgatcggcc tggtcgtggt ggccggcatc gtcttcggtc tggcgggcat gacgttcgcg       720
     gcgctcacgc accggctcag ccgcctgttg aagcgtcaca tcgcctttgg gccgctccgc       780
     cccgtgctgg gcggcagcgt ggtcgtggcg gcggcgttgg cgctggggac ggacaaatat       840
     ctcggcctcg gcattccggt catcgtggat acgttccaca atccgctgcc cgcctacgac       900
     tttgccggca aggcggcctt caccatcgtg acgctggcgt ccggtttcaa gggcggtgag       960
     gtcacgccgc tgttctacat cggcgccacg ctgggcaatg cgttgggtta cgtgctgccg      1020
     ttgcccttcc cgctgctggc gggccttggg ttcgttgccg tgtttgcggg tgccgccaat      1080
     acgcccatcg cgtcgacctt gatggcgatg gaactcttcg gccccgaagt cggcacattt      1140
     gctggcattg cctgcgtggt gagctatctc ttctcaggcc acaccggcat ctatcatgcg      1200
     cagcgcatcg gccatgcgaa gcgccctacc gaagcagcgc cggcagggca ggttccggcc      1260
     gagtcagccg agcgccctta g                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page