(data stored in ACNUC7421 zone)

EMBL: CP001069.PE211

CP001069.PE211       Location/Qualifiers
FT   CDS_pept        complement(248808..249518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3982"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Helix-turn-helix type
FT                   11 domain protein; KEGG: bmu:Bmul_4707 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3982"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29087"
FT                   /db_xref="GOA:B2UHN6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHN6"
FT                   /protein_id="ACD29087.1"
FT                   /translation="MGNDGVAAVEKALALLDCFKPGAEALSLAALAQASGMHKTTVYRL
FT                   MNSLERMSYVIRSESGAYSLGPRLLYLGKLYEQSFHLSSVVEPVLHALAAATRESASYY
FT                   VVDHGRRLCLFRAEPSEGLRETRLPGTSLPLDDTAISHVLRYWGLGEALYDETPKLPLF
FT                   TSGARDQHTAAFATPIFGSGDKFMAALTLSGAASRLEAARTSGDVVAKQLQAASDLSRK
FT                   LGASAALCERFYGV"
     atggggaatg acggcgttgc cgcagtagaa aaggcgctgg ccttgctgga ttgcttcaag        60
     ccgggggcgg aagccttgtc gctcgcagcc ttggcgcaag cctcgggcat gcacaagacc       120
     acggtgtatc ggctgatgaa ctcgctggag cgcatgagct atgtcatccg ctccgagtcc       180
     ggcgcgtact cgctcgggcc acgcctgctg tatctcggca agctctacga gcagtcgttc       240
     cacttgtctt ccgtggtgga accggtgctg cacgcgctgg cggccgccac gcgagagagc       300
     gcatcgtact acgtcgtcga tcacggccgg cggctgtgcc tgttccgcgc cgagccctcg       360
     gaaggcctgc gtgagacgcg gctgcccggc acgtcgctgc cgctggacga cacggccatc       420
     agccacgtgc tgcgttactg ggggctgggt gaagcgctgt atgacgaaac acccaagctg       480
     ccgctgttca cctcgggcgc gcgggaccag cacacggcgg cgtttgccac gcccatcttc       540
     ggttccggcg acaagttcat ggctgcgctg acgctgtcgg gcgcagcctc ccggctggaa       600
     gcggcacgca cctctgggga tgtcgtcgcg aagcagttgc aggcggcgtc cgacctgtcg       660
     cgcaaactcg gcgcaagtgc ggcgttgtgc gaacgcttct acggtgtttg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page