(data stored in ACNUC7421 zone)

EMBL: CP001069.PE213

CP001069.PE213       Location/Qualifiers
FT   CDS_pept        250386..251336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3984"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: bch:Bcen2424_5397 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3984"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29089"
FT                   /db_xref="GOA:B2UHN8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHN8"
FT                   /protein_id="ACD29089.1"
FT                   /translation="MSTTATKPVLLVTAADLAPQALEMLGDFEVVFAGKQPTEDDIVAL
FT                   CARHKPVAIIVRYGKINARIMDAAAGNLQVISKHGSGIDVIDQDAAAARGIAVRAAVGA
FT                   NAAAVAEHAWALILACAKSVPQLDARMRAGHWDKATHKSVELDGRTLGLVGLGAIGRRT
FT                   AAIGLAFGMKVLAFDPYTKEAPAGVQLVALGELYAQSDVVSLHCPLTAENRKMLNRDAF
FT                   SCFKPGAILVNTARGGLIDEAALVEALANGRLRAAGLDSFDVEPMTVPHPFQGVANIIL
FT                   SPHIGGVSDAAYVNMGKGAAANVLAVIEERASTAA"
     atgagcacga ctgcaaccaa gcctgtcctg ctcgtcacgg cggctgacct ggcaccgcaa        60
     gcattggaga tgctgggcga ttttgaagtc gtgtttgccg gcaagcagcc caccgaagac       120
     gacatcgtcg cgctctgcgc acggcacaag ccggtggcga tcatcgtgcg ctacggcaag       180
     atcaacgccc gcatcatgga tgcagccgcc ggcaacctgc aggtgatctc caagcacggc       240
     agcggtatcg acgtcatcga tcaggatgct gccgcggcgc gtggcattgc ggtgcgtgcc       300
     gcggtggggg ccaacgcggc tgctgtggcc gagcatgcgt gggcgctgat cctcgcatgc       360
     gcaaagtccg tcccgcagct cgacgcgcgc atgcgtgctg ggcattggga caaggcgacg       420
     cacaagtcgg tcgaactgga tggccgcacg cttggcctgg tcggcctggg tgcgatcggg       480
     cgccggactg ctgccatcgg cctggcgttc gggatgaagg ttcttgcatt cgacccgtac       540
     acgaaagagg cgccggcagg cgtccagctg gtggcgctcg gtgagttgta cgcgcagtct       600
     gacgtggtct cgctgcactg cccgttgacc gccgagaacc gcaagatgct gaaccgcgac       660
     gcgttcagct gcttcaagcc cggcgcgatt ctggtcaaca cggcgcgcgg cggcctcatt       720
     gacgaagccg cgctggtgga agcgctggcc aacggccgac tccgtgcagc ggggctcgac       780
     agcttcgacg tggagccgat gacggtgccg catccgttcc agggcgttgc caacatcatt       840
     ctgtcgccgc acatcggcgg cgtgagcgac gcggcctacg tgaacatggg taagggcgcc       900
     gcggccaatg tgctcgcagt gatcgaggaa cgtgccagca cggcggcgtg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page