(data stored in ACNUC7421 zone)

EMBL: CP001069.PE219

CP001069.PE219       Location/Qualifiers
FT   CDS_pept        complement(258219..259235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3990"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: atc:AGR_L_1441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3990"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29095"
FT                   /db_xref="GOA:B2UHP4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHP4"
FT                   /protein_id="ACD29095.1"
FT                   /translation="MSKPPHSHFDTSALPREHQFAAWRDAINVLFDSRSAAPQSHGFQA
FT                   SVDAYLCGETGVGMLSAQAQHYDRSRSKLGRDGMDVYVLQYYLEGSCGQRDGASDSATR
FT                   PGDLFIVDAAQPLATSTTDSRFLSLAVPRRLLAPLLRAPDELSMRVLRGGAPMVGLLRD
FT                   HLCSLYHSVGKLSDAEAQAVIPGTLQLAAAAINCQVTEANAPAVRESLFASVCRHVQHN
FT                   LSDLALSPEGVSVQFGISRATLYRLFEREGGFFNYLRMQRLRQCHAILADRSQTHRSVA
FT                   EIAQTYGFSDASNFARAYRRATGMSPRETRMLAVEGRAAAMPFVQHKDWRTWVMQMR"
     gtgagcaaac ctccgcattc ccacttcgat acgtctgcgc tgccgcgcga gcatcaattt        60
     gcggcgtggc gggatgccat caacgtgctg ttcgattcgc gctccgccgc gccgcagtcg       120
     catggctttc aggccagcgt cgacgcctat ctgtgcggcg agacaggtgt gggcatgctc       180
     agcgcccagg cacagcacta tgaccggtcc cgctccaagc tggggcgcga cggcatggac       240
     gtctacgtgc tccagtacta cctggaaggc agttgcggac agcgcgacgg cgcaagcgac       300
     agcgccacgc gccccggcga tctgttcatc gtcgacgcag cccagccgct cgccacaagc       360
     acgaccgaca gccgcttcct gagcctggcc gtgccacggc gcctgctggc accgctgctg       420
     cgcgcacccg acgaactgag catgcgcgtg ctgcgcggcg gtgctccgat ggtcgggctg       480
     ctgcgcgatc acctgtgttc gctctatcac tcggtcggga aattgagcga tgccgaagca       540
     caggccgtca tcccgggcac cctgcaactg gctgcggccg ccatcaactg ccaggtgacc       600
     gaagccaatg cgccggccgt gagggaaagc ctgtttgcct cggtctgccg gcatgtgcag       660
     cacaatctgt ccgacctggc gctttcgccc gaaggcgtgt cggtgcagtt cggcatctcg       720
     cgtgccacgc tgtaccggct gttcgagcgc gaaggcggct tcttcaacta cctgcgcatg       780
     cagcgcctgc ggcagtgcca cgcgatcctg gccgaccgat cgcagacgca ccgttcggta       840
     gccgaaatcg cgcagaccta cggcttttcc gacgcctcga actttgcgcg tgcgtaccgg       900
     cgcgcgacgg gcatgtcgcc ccgcgagacg cgcatgctgg ccgtcgaagg gcgcgccgca       960
     gccatgccgt tcgtgcagca caaggactgg cgcacctggg tcatgcagat gcgctga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page