(data stored in ACNUC7421 zone)

EMBL: CP001069.PE220

CP001069.PE220       Location/Qualifiers
FT   CDS_pept        complement(259323..260840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3991"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: rso:RS04801 probable
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3991"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29096"
FT                   /db_xref="GOA:B2UHP5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHP5"
FT                   /protein_id="ACD29096.1"
FT                   /translation="MPLQRATGALLRRPSLLIIGASALSLVLAALTALSLWEMRSDALA
FT                   RARDAADNLALILQRDIARNIEVYDLSLQAVIDGVRDPAMLALPPAVRQLVLFDRSTNA
FT                   QDLGSLLVTDKAGDVVIDSHSVPPRHIYLGDRDYFQVHQASDDVGLYISEPFMPRATGL
FT                   ERSLGLSRRLNGPHGEFNGIVVGTLRLNYFRRLFDGINLGPHATVTLIRTDGTLLMRRP
FT                   YNEKLIGRNLADATAFQKRLLAPEGSYVDIAGIDDIERLFSFRHIGDHPLIVTVGLATE
FT                   DIYAEWWRRAWVISGIVLMLDAVFIVLSFLFAQQLRKRLEMEQQLHLLANTDSLTGLGT
FT                   RRALDSALDVEWRRANRHHTPMAVLMIDVDDFKPYNDRYGHAAGDTALRTVARCINDSI
FT                   KRPGDFAGRYGGEEFCAVLPNTDLGGAARVAESIRAAVLAANERNAGSAYGKLTVSIGV
FT                   AVHSGIAAEDDTLEDLVRLADGRLYEAKAAGRNVVMPRHERPKPAVV"
     atgcctttac agcgcgccac tggtgcactc ctgcggcggc cttctctgct gatcatcggc        60
     gcgtcggcgc tgtcgctggt gctggccgcg ctgaccgcgc tctcgctctg ggaaatgcgc       120
     tcggacgcac tggcccgcgc gcgcgatgcc gccgacaacc tcgcgctgat cctgcagcgc       180
     gacattgccc gcaacatcga ggtgtacgac ctgtcgctgc aggccgtgat cgacggcgta       240
     cgcgaccccg ccatgctggc gctgccgccc gccgtacgcc agctcgtgct gttcgaccgg       300
     tcgaccaacg cgcaggacct gggctcgctg ctggtgaccg acaaggccgg cgacgtggtc       360
     atcgattcgc actcggtgcc gccgcggcac atttacctcg gtgaccgcga ttatttccaa       420
     gtacatcaag cctccgacga cgtcgggctg tatatcagcg agccgttcat gccgcgcgcg       480
     actggcctcg agcgatcgct gggactcagc cggcgcctga acggcccgca cggcgaattc       540
     aacggcatcg tggtcggcac gctgcggctg aactacttca ggcggctgtt cgacggcatc       600
     aacctggggc cccacgccac cgtcacgctg atccgcaccg acggcacgct gctcatgcgg       660
     cgcccgtaca acgaaaagct catcggccgc aacctggccg atgccaccgc gttccagaag       720
     cggctgctcg caccagaagg ctcgtatgtg gacatcgcgg gcattgacga tatcgagagg       780
     ctgttcagct tccgccatat cggcgaccac ccgctgatcg tcaccgttgg ccttgccacc       840
     gaagacatct atgctgaatg gtggcggcgc gcatgggtga tcagcggcat cgtgctgatg       900
     cttgacgcgg tgttcatcgt gctgtcattc ctctttgcgc agcagctgcg caagcggctc       960
     gagatggagc agcaattgca tctgctggcc aataccgaca gcctgaccgg acttggcacg      1020
     cgccgcgcct tggattccgc cctcgacgtg gagtggcgcc gcgccaatcg gcatcacacc      1080
     ccgatggcgg tgctgatgat cgacgtggac gacttcaaac cctacaacga caggtacggc      1140
     cacgccgccg gcgacaccgc cctgcgcacg gtggcacgct gcatcaacga cagcatcaag      1200
     cgccccggcg actttgccgg ccgctatggc ggcgaggagt tctgcgccgt gttgccgaac      1260
     accgacctgg gcggcgccgc gcgcgttgcc gagagcatcc gcgctgccgt tctggccgcc      1320
     aacgagcgca atgctggcag cgcgtacggc aagctgaccg tgagcatcgg cgtggcggtg      1380
     cattcgggca ttgccgccga ggacgacacg ctggaagacc tcgttcgact ggcggacggg      1440
     cggctgtatg aagccaaggc cgccggccgc aacgtggtca tgccgcgaca cgagcggccc      1500
     aagccggctg tcgtctag                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page