(data stored in ACNUC7421 zone)

EMBL: CP001069.PE222

CP001069.PE222       Location/Qualifiers
FT   CDS_pept        261614..264247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3993"
FT                   /product="protein of unknown function DUF470"
FT                   /note="PFAM: protein of unknown function DUF470; protein of
FT                   unknown function DUF471; protein of unknown function
FT                   DUF472; KEGG: rso:RS04799 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3993"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29098"
FT                   /db_xref="GOA:B2UHP7"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHP7"
FT                   /protein_id="ACD29098.1"
FT                   /translation="MPDAASNDASPTSRRSSARTPPAAPATPVRSESGLGLAGWIVVGM
FT                   VLVLGALVFDSLYALLDHVHYADMVAALQATPRSHLLLAVLATALSYVALTGYDASGLR
FT                   YAGAHVAPGTVATTSFIAYALGNTVGLGSLTAGAVRTRLYTAAGLDPARVTEAVAFDAG
FT                   ALGVSTTAFGAVGLLWGAPHIATITHLPAPLLEVVALLVLAGVVALLVLCMRQRHVTLF
FT                   GRWEVRPPPPGLAARQFAISAADMIAAAAALWVLMPAGAVDLPTFVAFYALAVTLGVLS
FT                   QSPGGLGVFEAVILLGCSGQAPPAEVLAALLFYRAIYFLLPLVVAAAMLGAFELRSGAG
FT                   APFGRAAVKLSPGLLAALTMVAGVMLLVSGVTPASDEAEDLLRMHVPLFVVEASHMIGS
FT                   VAGLIMLFVARGLLHRLDAAWWAALVLSLLTGVLALPKGIAVSEMAVLVTLAVLLVISR
FT                   RQFDRPSSLFSQRLEAGWLLAMVCVFAACVWILFFAYREVAYANQLWWQFTFDGDAPRS
FT                   IRALMAVAVTGLGFGMWQLFRKEPGVTTFPSDEELARAAEIVRKQPAADATLALMGDKS
FT                   LLFSPSGNAFIMYAKQGRSWVALSDPVGAQQEWPELIWRFIEMADAHGGRAAFYKTRPQ
FT                   TLPLYLDAGLRAYKLGEEAYVSLPDFSLKGSRRANLRHGVTRGEREGLSFEIIPTADVP
FT                   TVLDELRAISDEWLRNQNAREKGFSLGAFDDRYIRSQPVAVVRREGVIVAFATLMCPDV
FT                   LRIEASVDLMRYRSDVPPGTMDFLFGKVILHFQAQGYQRFGLGMAPMSGMVEHQLAPRW
FT                   HRFGRMMFRHGARFYNFRGLRNFKDKFEPVWEARYLLARGGIAPLFTLTDVAALIGGGL
FT                   KGVISK"
     atgcctgacg ccgcgtccaa cgacgccagt ccaacatcgc gccgatcttc ggcccgcacc        60
     ccgcctgccg cgcccgccac gcccgtgcga tccgaatcgg gcctaggcct ggccggctgg       120
     atcgtggtcg gcatggtgct cgtgcttggc gcactcgtgt tcgacagcct gtatgcgctg       180
     ctggaccacg tgcactacgc cgatatggtc gccgcgctgc aggctacgcc gcgctcgcac       240
     ctgctgctgg ccgtgctggc cacggcgctg agctacgtcg ccctgaccgg ctacgacgcg       300
     tccggcctgc gctatgccgg cgcgcacgtc gccccaggca cggtggccac cacctcgttc       360
     attgcttatg cgctgggcaa caccgtcggt ctcggttcgc tgacggccgg ggcggtgcgc       420
     acgcgcttgt acacggcggc cgggctcgat cctgcccgtg tgacagaagc ggtcgccttc       480
     gatgcgggcg cgcttggcgt gtccaccacg gcctttggcg cggtcgggct gctgtggggc       540
     gcgccgcaca tcgctaccat tacgcatttg ccggcgccgt tgctcgaagt cgtggccctg       600
     ctggtgctgg ccggcgtcgt ggcgttgctc gtgctgtgca tgcggcagcg ccatgtgacg       660
     ctgtttggcc ggtgggaggt ccgcccgccg ccgccgggct tggccgcgcg tcagtttgcg       720
     atttcagcgg ccgacatgat tgccgcggcg gcggcgctgt gggtgctgat gccggcaggc       780
     gcggtcgacc taccgacgtt tgtggcgttc tatgcgctgg cggtcacgct gggcgtcctg       840
     agccagagcc cgggcggcct gggtgtgttc gaggccgtca tccttctggg ctgcagcggc       900
     caggcgccgc cggccgaggt gctggccgcg ctgctgttct accgcgccat ctatttcctg       960
     ctgccactgg tcgtggccgc tgccatgctt ggcgccttcg agttgcgctc cggcgccggg      1020
     gcaccgttcg gccgcgctgc ggtcaagttg tcgccggggc tgttggccgc gctgacgatg      1080
     gtggccggcg tgatgctgct ggtctcgggc gtcacccctg ccagcgacga agcggaagac      1140
     ctcctgcgca tgcacgtgcc gctgttcgtg gtggaagcct cgcacatgat cggtagcgtg      1200
     gcggggctca tcatgctgtt tgtcgcacgc gggctgctgc accggctgga tgccgcgtgg      1260
     tgggcggcgc tggtgctgtc gctgctgacc ggcgtgctgg cgctgcccaa gggcattgcc      1320
     gtgtcggaga tggcggtgct ggtgacgctg gcggtgctgc tcgtcatctc gcgccggcag      1380
     ttcgatcggc cgtcgtcgct gttctcgcag cggctggagg cggggtggct gctcgccatg      1440
     gtgtgcgtgt ttgcggcgtg cgtgtggatt ctcttcttcg cctaccgcga ggtggcctac      1500
     gccaaccagc tctggtggca attcacattt gacggcgatg cgccacgttc catccgcgcg      1560
     ctgatggccg tggccgtcac cgggctcggc ttcggcatgt ggcagctctt tcgcaaggag      1620
     ccaggcgtta cgaccttccc gagcgacgaa gaactcgccc gcgcggccga gatcgtccgc      1680
     aagcagcctg ccgccgatgc cacgctcgcg ctgatgggcg acaagagcct gctgttctcg      1740
     ccgtcgggca acgcgttcat catgtacgcc aagcaggggc gctcgtgggt ggcgctgtcc      1800
     gaccccgtgg gcgcgcagca ggagtggccc gagctgatct ggcgctttat cgaaatggcc      1860
     gacgcgcatg gcgggcgcgc cgcgttctac aagacgcggc cgcagacgct gccgctgtat      1920
     ctcgatgccg gcctgcgtgc ctacaagctg ggcgaagagg cgtatgtgtc gctgcccgac      1980
     ttcagcctca agggctcgcg ccgcgccaat ctgcgccatg gcgtgacgcg cggcgagcgc      2040
     gaagggctgt cgttcgagat catcccgacg gcagacgtgc cgaccgtcct ggacgaattg      2100
     cgggccattt ccgatgaatg gctgcgcaat cagaacgcgc gcgagaaagg cttctcgctc      2160
     ggcgcatttg acgaccgcta catccgcagc cagcccgtgg ccgtggtgcg ccgcgagggc      2220
     gtcatcgtgg cgtttgccac gctgatgtgc cccgatgtgc tgcgcatcga ggcgagcgtg      2280
     gacctgatgc gctatcgcag cgacgttccg cccggcacga tggatttcct gtttggcaag      2340
     gtcatcctgc acttccaggc gcaggggtat cagcgtttcg ggctgggcat ggcgccgatg      2400
     tcgggcatgg ttgagcatca gcttgcgccg cgctggcacc gcttcggacg gatgatgttc      2460
     cggcacggtg cgcgcttcta caatttcaga gggctgcgca atttcaagga caaattcgag      2520
     ccggtgtggg aagcccgcta cctgctcgca cgtggcggta tcgcgccgct gttcacattg      2580
     acggacgtcg ctgcgctgat cggcggcggc ttgaagggag tgatctccaa atga            2634
//

If you have problems or comments...

PBIL Back to PBIL home page