(data stored in ACNUC7421 zone)

EMBL: CP001069.PE223

CP001069.PE223       Location/Qualifiers
FT   CDS_pept        264244..266010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3994"
FT                   /product="virulence factor family protein"
FT                   /note="PFAM: virulence factor family protein; KEGG:
FT                   rso:RS04798 probable AcvB-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3994"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29099"
FT                   /db_xref="GOA:B2UHP8"
FT                   /db_xref="InterPro:IPR010333"
FT                   /db_xref="InterPro:IPR011225"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHP8"
FT                   /protein_id="ACD29099.1"
FT                   /translation="MSWQAPRTQEARHRGVLRKGLRLAGHVGAVGMVLAASWAIAADAP
FT                   APTSKPTPVQGAVLVPPVGMTGASGVVAVPPRGDMPPRLQMSGPAVTANKAANGGVLSL
FT                   PVVAPATPAAAPGAVEFVTHGRFRDVPVYKPKGEIRSVVLMLSGDLGWTPAASRMAESL
FT                   AQQGALVAGLSTPALFASLEADPGDCAFPDGDLENFSRFLQAYEKVPGYYPPILVGDNE
FT                   GGALAYAMIAQARPNIFAGAMSMEFCPVLELRKPLCKGEGVHFSRRMSESRTTAKRVKP
FT                   PENAGVVLLPATKLSAPWVALQSAMPTSFARRSGPLCDARATQAFIDTISGAQSVALPA
FT                   MATGANAPPVTASEPFKTAFAKLVAQRKPPPPPPPAAVSDLPIIEVPAQPGSSSELFAV
FT                   LLSGDGGWAGLDKEVAAALSKSGVPVVGIDSLRYFWTPRTPASAAADMDRLVRFYASRW
FT                   KKQKALLIGYSQGADVLPFIVNRLPAASREHVALAVMMGLGKRADFEFHMTNWVSSSAS
FT                   GLLILPEVQKLPAGLGMCIYGKEEKDTNCPGLDPKQVQLVKLPGGHHFDGDYAKLARIS
FT                   LEGARAPGNASR"
     atgagttggc aagcaccgcg cacgcaagag gcgcggcatc ggggagtgct acgcaaaggc        60
     ttgcgtttgg ccgggcatgt gggtgcggtc ggcatggtgc tggcagcgtc ctgggccatc       120
     gccgccgacg ctcctgcgcc tacatccaaa ccgacgcccg tgcagggcgc ggtgctggtt       180
     cctcccgtgg gcatgacggg cgccagtggt gtcgtggcag tgccgccgcg cggtgacatg       240
     ccgcctcggc tgcaaatgag cgggccggcc gtgacggcca acaaggctgc caacggcggc       300
     gtgctgtcgc tgccggtggt ggcgcccgct acgcccgccg ccgcaccggg cgcggtcgag       360
     ttcgttacgc acgggcgttt tcgcgatgtg ccggtctata agccgaaggg cgaaatccgc       420
     tccgtcgtgc tgatgctgtc gggcgacctg ggctggacgc ccgccgcatc gcgcatggca       480
     gagagcctcg cgcagcaggg cgcattggtg gcaggcctgt cgacgcctgc gctgttcgcc       540
     agcctggagg cagatccggg cgattgcgct ttccccgatg gcgatctcga aaacttcagc       600
     cgcttcctgc aggcctacga aaaggtgccc ggctactacc cgcccatcct cgttggcgac       660
     aacgaaggcg gtgcgctggc ctacgccatg attgcccagg cgcgcccgaa catctttgcc       720
     ggggccatgt cgatggagtt ctgtccggtg ctggagctgc gcaagccgtt gtgcaagggc       780
     gagggcgtgc acttcagccg ccgcatgagc gagagccgca ccacggccaa acgcgtcaag       840
     ccgcccgaga acgccggggt ggtgctcctg ccggccacga agttgtctgc gccttgggtg       900
     gcgctgcaat ccgccatgcc gacgtcgttt gcgcgccgct ccggtccgct gtgcgacgcg       960
     cgtgccacgc aagccttcat cgatacgatt tccggggcgc aatcggtggc gttgccggcc      1020
     atggcaacgg gcgccaatgc gccgcctgtg acagccagcg aaccgttcaa gaccgccttc      1080
     gccaagcttg tcgcccagcg caagccgccg cccccgccgc cgcccgcggc ggtgtctgac      1140
     ctgccgatca tcgaagtgcc cgcgcagccc gggtcatcgt ccgagttgtt tgcggtgctg      1200
     ctctcgggag acggcggttg ggcggggctg gacaaggagg ttgcggccgc gctgtccaag      1260
     tcgggcgtgc ccgtggtggg catcgattcg ctgcgctact tctggacgcc ccgcacgccg      1320
     gcctctgccg ccgccgacat ggaccgcctc gtgcgtttct atgcgtcgcg ctggaagaag      1380
     cagaaggccc tgttgatcgg ctattcgcag ggcgcagacg tgctgccctt catcgtcaac      1440
     cggttgccag cggcgtcgcg cgagcatgtc gcgctggcgg tcatgatggg cctgggcaag      1500
     cgtgccgatt ttgagttcca catgaccaac tgggtgtcga gcagcgcctc tggcttgctg      1560
     atcctgcccg aggtgcagaa gctgccggcg gggctgggca tgtgcatcta cggcaaggaa      1620
     gagaaggaca ccaattgccc gggcctggat ccgaagcagg tgcagctcgt gaagctgcct      1680
     ggcggccatc actttgatgg cgattacgcc aagctcgcgc gcatcagtct cgaaggcgcg      1740
     cgtgcaccgg gcaacgcctc gcgctga                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page