(data stored in ACNUC7421 zone)

EMBL: CP001069.PE225

CP001069.PE225       Location/Qualifiers
FT   CDS_pept        complement(267871..268422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3996"
FT                   /product="putative alanine-rich signal peptide protein"
FT                   /note="KEGG: rso:RS04795 probable alanine-rich signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3996"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29101"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ0"
FT                   /protein_id="ACD29101.1"
FT                   /translation="MKLSALMFSIGALVMGSAFAQGTAAPATAPAAAPAAAPAAVHAVC
FT                   KDGTPYSGATLKGACRGHGGVDKKASAGGAPAAAPAAAPAASAPAKPAAAAPAAPAAAP
FT                   APAPAAKPAAAAPAKPAAAAAATVAPGGGPDKVWANASTKVYHCPGDRYYGKTKQGEYM
FT                   TEADAKAAGMRPSRNKACTK"
     atgaaactgt ctgcgttgat gttttcaatc ggtgcgctgg tgatgggttc agcgtttgcg        60
     cagggcaccg ccgcacccgc caccgcaccg gcagcggccc cggcagcggc cccggcggcc       120
     gtccacgcgg tctgcaagga cggcacgccc tatagcggcg cgacgctcaa gggcgcctgc       180
     cgcggccacg gtggtgtcga caagaaagcc agcgcaggcg gtgctccggc tgccgcgccc       240
     gcagcggcgc ctgccgcatc ggctccggcc aaacctgcgg ccgcggctcc tgcggcgcct       300
     gccgcagcac cggctccggc gccagcagcc aaacccgcag cagcagcgcc tgccaaaccg       360
     gccgcggccg cagcggccac cgttgcccct ggcggcggcc ccgacaaggt atgggccaat       420
     gccagcacca aggtctacca ctgcccgggc gatcgctact acggcaagac caagcaaggc       480
     gaatacatga ccgaagccga cgccaaggcc gccggcatgc gcccaagccg caacaaggcc       540
     tgtaccaagt aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page