(data stored in ACNUC7421 zone)

EMBL: CP001069.PE228

CP001069.PE228       Location/Qualifiers
FT   CDS_pept        270729..271370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_3999"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: rso:RS04794
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_3999"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29104"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ3"
FT                   /protein_id="ACD29104.1"
FT                   /translation="MKPTEENRLLLREGRKIVEALGKTLAPLVEVVLHDLTDPDHAVVA
FT                   IANNLSGRQVGDAVTELGLARLADPDFPEVIENYANRFPDGRPAKSTSIGLKNSRGDYV
FT                   AAICLNMDVSMLHAVTTGLTQLMRVDAAAPPVPESLGSRRVEDVRIALEQFAAARNTTP
FT                   MAMTLDQRREAMRELAVSGLLNLRRALTEVAQTLGVARSTVYTYLPEDLA"
     atgaagccca ctgaagaaaa ccgccttctg ctgcgcgaag gccgaaagat cgtcgaggcg        60
     ctgggcaaga cgctggcgcc gctggtggaa gtcgtcctgc acgacctgac cgatcccgat       120
     catgccgtcg tcgccatcgc caacaacctg tccggccgcc aggtgggcga cgccgtgacg       180
     gaactgggac tcgcgcgcct ggccgacccc gacttcccgg aagtcatcga gaactacgcc       240
     aaccggtttc ccgacgggcg cccggccaag agcacatcga tcgggctgaa gaacagccgc       300
     ggcgattacg tggcggccat ctgcctgaac atggatgtct ccatgctgca tgccgtgacc       360
     accggcctca cgcaactgat gcgcgttgat gcggctgcgc cgccagtgcc cgagtcgctt       420
     ggctcccgtc gcgtggaaga cgtgcgcatc gcgctcgaac agtttgctgc cgcccgcaac       480
     accacaccca tggccatgac cctcgaccag cgccgcgagg ctatgcgcga actggccgtc       540
     agtggcctgc tgaacttgcg ccgcgcgctg accgaagtcg cccagacact cggcgtggcg       600
     cgctccaccg tctacaccta tcttcccgag gatctcgcat ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page