(data stored in SCRATCH zone)

EMBL: CP001069.PE229

CP001069.PE229       Location/Qualifiers
FT   CDS_pept        271367..272344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4000"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: rso:RS04793 serine/threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4000"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29105"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ4"
FT                   /protein_id="ACD29105.1"
FT                   /translation="MSLPISYDDVVAAHARLQGVAHKTPVLTSATANAMTGAELFFKAE
FT                   SFQRMGAFKFRGAYNALSQFTPEQRRAGVITFSSGNHAQAIALSAKLLGMRAVIVMPKD
FT                   APVVKVEATRGYGGEVVFFDRYTEDREAIGRQLAEEHGLTLIPPYDHPHVMAGQGTAAK
FT                   ELIEEVGPLDVLLAPLGGGGLLSGCATAARALNPACKIFGVEPEAGNDGQQSLRKGEIV
FT                   HIDTPKTLADGAQTQHLGNYTFAVIRELVDDIVTVSDAELVSAMQFFASRMKAVVEPTG
FT                   CLAAAAVLNGKVDVRGKRVGVILSGGNVDLQLFAKLVLGAEAAK"
     atgagcctgc ccatttccta cgacgacgtc gttgccgccc acgcccgcct gcagggtgtc        60
     gcccacaaga cgccggtgct gacctctgcc accgccaacg ccatgaccgg cgccgaactg       120
     ttcttcaagg ccgagagctt tcagcgcatg ggcgcgttca agtttcgtgg ggcgtacaac       180
     gcgctgtcgc aattcacgcc ggagcagcgc agggccggcg tgatcacgtt ctcgtcgggc       240
     aaccacgcgc aggcgattgc gttgtcggcc aagctgctcg gcatgcgcgc cgtcatcgtc       300
     atgccgaagg acgcgcctgt cgtgaaggtg gaggccacgc gtggctacgg cggcgaggtg       360
     gtgttcttcg accgctacac cgaagaccgc gaagccatcg gccgccaact ggccgaagaa       420
     cacggcctta cgctgatccc gccgtacgac catccgcacg tgatggccgg gcagggcacg       480
     gctgccaagg aactgatcga agaggtcggc ccactggatg tgctgctggc cccgctgggc       540
     ggtggcggtc tgctctccgg ctgcgccacg gcggcgcgcg cgctgaaccc ggcgtgcaag       600
     atcttcggcg tggagcccga ggcaggcaac gacggtcagc agagcttgcg caagggcgag       660
     atcgtccaca tcgatacacc caagacgctg gccgacggcg cgcagacgca gcacctgggc       720
     aactacacgt ttgccgtgat tcgcgaactg gttgacgaca tcgtgaccgt gagcgatgca       780
     gaactcgtca gcgccatgca gtttttcgcc tcgcgtatga aggcggtggt cgagcccacc       840
     ggctgcctgg ctgcagctgc ggtgctgaac ggcaaggtcg atgtgcgagg caagcgcgtc       900
     ggcgtgatcc tgtcgggcgg caatgtggat ctgcaactct tcgccaagct tgtgctgggc       960
     gcggaggcag cgaaatga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page