(data stored in ACNUC7421 zone)

EMBL: CP001069.PE230

CP001069.PE230       Location/Qualifiers
FT   CDS_pept        272341..272730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4001"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: rso:RS04792
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4001"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29106"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ5"
FT                   /protein_id="ACD29106.1"
FT                   /translation="MSDARYLNAPQLRPPAGHYSHAVCANGFVFVAGQIPVTPTGEKLV
FT                   DAPFETQVRQVLSNLDAVLAAAGTDRSRLVQVRVYVTDMESHWPAFDALYSAWIGELRP
FT                   ARAVVPVPTLHYGLAVEIEATAVAG"
     atgagcgatg cacgctacct gaacgcgccg caactgcgcc cgcctgcggg gcattactcg        60
     cacgcggtct gcgccaatgg cttcgtgttc gtcgccggac agattcccgt gacgcccacc       120
     ggcgaaaagc tcgttgacgc gccgttcgag acgcaggtgc ggcaggtgct gtccaacctg       180
     gacgctgtgc ttgccgccgc aggcacggac cgctcgcgcc tggtacaggt gcgcgtgtac       240
     gtgacagaca tggaatcgca ctggcccgcg ttcgatgcgc tctatagcgc gtggatcggc       300
     gagttgcgtc cggcgcgcgc cgtcgtgccg gtaccgacgc tgcactacgg gctggctgtc       360
     gagattgagg ccactgcagt tgctgggtga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page