(data stored in ACNUC7421 zone)

EMBL: CP001069.PE231

CP001069.PE231       Location/Qualifiers
FT   CDS_pept        272882..273763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4002"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   reh:H16_A1321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4002"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29107"
FT                   /db_xref="GOA:B2UHQ6"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ6"
FT                   /protein_id="ACD29107.1"
FT                   /translation="MILQKTRQLTQEDVPVGQPLPFPLADSVGRLLLPAGAVVPDAEDV
FT                   RLLFHHGPVLALAEGDDIAAVPATAPAEAPPRIGSAGLSVGTVLQVQEKSAPLRGLLPC
FT                   RLIGYIEGEALFVTQPADAKRTLRPEPRDVLILRGFSGRSVFTMMCSVVSVGQFPSPYL
FT                   VLSAPIKMQKMPLRRAKRVQVRIGARVRAQGQAASAADRVAVIRDICLNGALVQSANPA
FT                   FQPGDRLALDFNAYVDGQLETFSLTGRVASGSPALGTTASAFPSFGVEFTLSKEQTAQL
FT                   SHLIIERLDENA"
     atgatccttc agaaaacgcg gcaactcacg caggaagacg ttccggtcgg tcaaccgctg        60
     ccgtttcccc tggctgacag tgtgggccgg cttttgctgc ccgccggtgc tgtcgtgccg       120
     gatgccgaag acgttcgcct tctgttccat cacggcccgg tgctggcact ggcagaaggt       180
     gatgacattg ccgccgtgcc tgccaccgcg cccgcagaag ctccgccccg cattgggtcg       240
     gccggcctga gtgtcggcac ggtcttgcag gtgcaggaga agtccgcacc gctacgtggc       300
     ctgctcccgt gccgcctgat cggttatatc gaaggcgaag cgctgtttgt cacgcagcca       360
     gccgacgcca agcgcacgct gcggcccgag ccgcgagacg tgctgatact gcgcggtttt       420
     tccggccgct cggtattcac catgatgtgc agcgtggtgt cggtgggaca gtttccctcg       480
     ccgtatctgg tcttgtcggc gcccatcaag atgcagaaga tgccgctgcg ccgtgccaag       540
     cgcgtgcagg tccggatcgg ggcgcgcgtg cgtgcgcagg ggcaggccgc gtcggctgcg       600
     gatcgcgtgg cggtgatccg cgacatctgc ctgaacggtg cgctggtgca gagcgccaac       660
     cccgcgttcc aacccggcga cagactcgcc ctggatttca atgcctacgt ggacggccag       720
     ttggagacgt tttccctgac cggccgggtg gcaagcgggt cgcctgcgct gggcacaacc       780
     gcatctgcgt ttccttcgtt tggcgtggaa ttcacgctgt cgaaagagca gacagcccaa       840
     ctctcgcatc tgatcatcga acggctggac gaaaacgcgt ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page