(data stored in ACNUC7421 zone)

EMBL: CP001069.PE232

CP001069.PE232       Location/Qualifiers
FT   CDS_pept        complement(273768..274652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic_4003"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RS04791 putative transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic_4003"
FT                   /db_xref="EnsemblGenomes-Tr:ACD29108"
FT                   /db_xref="GOA:B2UHQ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2UHQ7"
FT                   /protein_id="ACD29108.1"
FT                   /translation="MRHSPEALLAFAEAATLGSFSAAARKLGKRQSTISEAIANLEIDL
FT                   GLTLFDRSTRQPTLTEAGHAMLTQVRRVLDASAQMDRMAAQMAGGLEARLTLVMSDTYQ
FT                   SDRYEQTLATLEQRYPDLELECLIAEHEDVVDIIQLGRAQIGLVAAQAAYPADIGWATI
FT                   AEQSEIGLFVGLQHPLARYGDEEVPHAILREARELRLNTFVDPTGPRTDAVPVRSLRRW
FT                   SAPSYLMLLEMAVLGFGWTELPRWLVDHFAADRLHEVRARGWPRLVPVDAVWSRNRTLG
FT                   QAGAWLLETMLAG"
     atgcgtcatt cacccgaagc cttactggcc tttgccgaag ccgccacgct aggttccttt        60
     tccgccgctg cccgaaaatt gggcaagcgg caatccacga tcagcgaggc gatcgccaat       120
     cttgaaatcg acctcggtct gacactgttc gaccgcagca cgcgccagcc caccttgacc       180
     gaagcgggcc acgcgatgct cactcaggtg cgccgcgtgc tcgacgccag cgcgcagatg       240
     gaccgcatgg ccgcccagat ggccggcggt ctggaagcgc gcctgacgct cgtcatgtct       300
     gacacctacc aatccgatcg ctacgagcaa acgctggcca cactggagca gcgttatccc       360
     gaccttgaac tcgaatgcct gatcgccgaa cacgaagacg tggtcgacat catccagctg       420
     ggccgtgccc agatcggttt ggtggccgcg caggcggcat atccggccga tatcggctgg       480
     gcgaccattg cagagcaatc ggagatcggg ctgttcgtgg ggctgcagca cccactcgcc       540
     cgatacggcg acgaggaagt gccacacgcc atactgcgcg aggcgcgcga gctacggctg       600
     aacaccttcg tcgacccaac ggggccacgc accgacgcgg tgcccgtgcg cagcctgcgc       660
     cgctggtctg caccgagcta cctaatgctg ctggaaatgg ccgtgctggg cttcgggtgg       720
     acggagctgc cgcgctggct ggtggatcac ttcgcggcag accggttgca tgaggtgcgt       780
     gcacggggct ggccccgcct cgtgccggtg gacgccgtat ggtcacgcaa tcgcacactt       840
     gggcaggccg gcgcctggct ccttgaaacg atgctggcgg gctag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page